y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G182600.6
FamilyCBM45
Protein PropertiesLength: 801 Molecular Weight: 90145.7 Isoelectric Point: 6.1705
ChromosomeChromosome/Scaffold: 08 Start: 46046150 End: 46052878
Descriptionalpha-amylase-like 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM451252081.3e-26
  LHWGVSYLGDSGSEWDQPPKGMRPPGSIPIKDYAIETPLKKLSEGDIFHEVKIDFNPISEIAAIHFVLKDEETGAWYQHRGMDF
GH135247834.4e-35
  KASEISSLGFTVIWLPPPTESVSPEGYMPKDLYNLNSRYGTIDELKELVKSLHEVGMKVLGDVVLNHRCAHFKNQNGVWNIFGGRLNWDDRAVVADDPHF
  QGRGNKSSGDNFHAAPNIDHSQEFVRKDLKEWLGWLREEIGYDGWRLDFVRGFWGGYVKDYLEASGPYFAVGEYWDSLSYTYGEMDHNQDSHRQRIVDWI
  NATNGTAGAFDVTTKGILHSALERCEYWRLSDQKGKPPGVVGWWPSRAVTFIENHDTGST
Full Sequence
Protein Sequence     Length: 801     Download
MAAVTIDSLL QNPTLLFRPK AKVLLKPPRS LDCSRNRKLP LSRGSCLCSF NPRRTIHVVR    60
ASSSETALIG NFDISSSDDI LYKDIFPVKR IEKVEGKFFI RLDRSKDQHD WQFTVGCSLP    120
GKWILHWGVS YLGDSGSEWD QPPKGMRPPG SIPIKDYAIE TPLKKLSEGD IFHEVKIDFN    180
PISEIAAIHF VLKDEETGAW YQHRGMDFKV PLVDYLEDDG NIVGAKRGFG VWSGALQQFS    240
NVLLKSEASH ADSQNNSIES KDSKNKNRCL EGFYEEQSIV KEVSVGNLVS VAVRKSPETG    300
KVVVCLETDI PGDVVVHWGV CRDDAKIWKI PAAPYPPETT VFKNKALRTL LQPKATGNRS    360
GALFTLDEEH FGFLFVLKLD DNTWLKFKEN DFYVPLLGTS SVPGQYGQSD STSEEISSKS    420
YTDGIINEIR NLVSGLSSEK SLKTKKKEVQ ESILQEIEQL AAEAYSIFRS SITTVPDEVV    480
SETETTKPAV KISSGTGTGF EILCQGFNWE SHKSRRWYME LKEKASEISS LGFTVIWLPP    540
PTESVSPEGY MPKDLYNLNS RYGTIDELKE LVKSLHEVGM KVLGDVVLNH RCAHFKNQNG    600
VWNIFGGRLN WDDRAVVADD PHFQGRGNKS SGDNFHAAPN IDHSQEFVRK DLKEWLGWLR    660
EEIGYDGWRL DFVRGFWGGY VKDYLEASGP YFAVGEYWDS LSYTYGEMDH NQDSHRQRIV    720
DWINATNGTA GAFDVTTKGI LHSALERCEY WRLSDQKGKP PGVVGWWPSR AVTFIENHDT    780
GSTQVLSSLE SFTLPLFHFF *                                              840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09441PRK094412.0e-46501797368+
PLN00196PLN001965.0e-96492786307+
PLN02361PLN023611.0e-124499784289+
cd11314AmyAc_arch_bac_plant_AmyA3.0e-133502784285+
PLN02784PLN0278401784793+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX33231.1017841793plastid alpha-amylase [Malus x domestica]
GenBankAAX33233.104078438787plastid alpha-amylase [Actinidia chinensis]
EMBLCBI32016.1017841777unnamed protein product [Vitis vinifera]
RefSeqXP_002270049.1017841793PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002520134.1067841793alpha-amylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3bsg_A05017862298A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
PDB2qps_A05017862298A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarb
PDB1rpk_A05017862298A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarb
PDB1p6w_A05017862298A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarb
PDB1ht6_A05017862298A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- Amylase Isozyme 1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63118380017840
ES8054483274587840
HO8269812984877840
DR9327832845017840
DY3946052854987820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00059.2.125.200Aquca_002_00059.2.125.200Aquca_002_00059.1.125.200Aquca_002_00059.1.125.200Aquca_010_00076.4
Aquca_010_00076.3Aquca_010_00076.2Aquca_010_00076.1Aquca_002_00499.4.322.398Aquca_002_00499.4.322.398
Aquca_002_00499.3.322.398Aquca_002_00499.3.322.398Aquca_002_00499.2.322.398Aquca_002_00499.2.322.398Aquca_002_00499.1.322.398
Aquca_002_00499.1.322.398Aquca_002_00059.3Aquca_002_00059.2.379.458Aquca_002_00059.2.379.458Aquca_002_00059.1.379.458
Aquca_002_00059.1.379.458Aquca_002_00499.4.126.212Aquca_002_00499.4.126.212Aquca_002_00499.3.126.212Aquca_002_00499.3.126.212
Aquca_002_00499.2.126.212Aquca_002_00499.2.126.212Aquca_002_00499.1.126.212Aquca_002_00499.1.126.212
Arabidopsis lyrata888368.117.192888368.117.192339218.127.210888368.391.469888368.391.469
492401
Arabidopsis thalianaAT1G10760.1.120.195AT1G10760.1.120.195AT1G69830.1.305.381AT1G69830.1.305.381AT1G69830.1.126.209
AT1G69830.1.126.209AT1G10760.1.394.472AT1G10760.1.394.472AT4G24450.1
Brachypodium distachyonBradi1g41907.2.109.184Bradi1g41907.2.109.184Bradi1g41907.1.109.184Bradi1g41907.1.109.184Bradi3g11270.1
Bradi2g48150.1.119.204Bradi2g48150.1.119.204Bradi1g41907.2.447.524Bradi1g41907.2.447.524Bradi1g41907.1.447.524
Bradi1g41907.1.447.524Bradi2g48150.1.299.375Bradi2g48150.1.299.375
Brassica rapaBra031749Bra018423.116.191Bra018423.116.191Bra016262.314.390Bra016262.314.390
Bra016262.127.210Bra016262.127.210Bra018423.389.467Bra018423.389.467Bra013803
Carica papayaevm.model.supercontig_69.90evm.model.supercontig_5.271.119.202
Capsella rubellaCarubv10008131mCarubv10019759m.318.394Carubv10019759m.318.394Carubv10019759m.133.214Carubv10019759m.133.214
Carubv10006877m
Citrus clementinaCiclev10030521mCiclev10030520mCiclev10030501mCiclev10030500mCiclev10030499m
Ciclev10030780m.171.247Ciclev10030661m.319.395Ciclev10030661m.319.395Ciclev10017434mCiclev10030661m.128.211
Ciclev10030661m.128.211
Citrus sinensisorange1.1g006158m.75.151orange1.1g004353m.317.393orange1.1g004353m.317.393orange1.1g003698m.219.295orange1.1g003698m.219.295
orange1.1g003613m.317.393orange1.1g003613m.317.393orange1.1g003004m.317.393orange1.1g003004m.317.393orange1.1g002611m.317.393
orange1.1g002611m.317.393orange1.1g002585m.317.393orange1.1g002585m.317.393orange1.1g001903morange1.1g001677m
orange1.1g001333morange1.1g001268morange1.1g001019morange1.1g004353m.126.209orange1.1g004353m.126.209
orange1.1g003698m.28.111orange1.1g003698m.28.111orange1.1g003613m.126.209orange1.1g003613m.126.209orange1.1g003004m.126.209
orange1.1g003004m.126.209orange1.1g002611m.126.209orange1.1g002611m.126.209orange1.1g002585m.126.209orange1.1g002585m.126.209
Cucumis sativusCucsa.286300.3Cucsa.286300.2Cucsa.286300.1Cucsa.285330.2.172.248Cucsa.285330.1.312.388
Cucsa.285330.1.312.388Cucsa.285330.1.120.205Cucsa.285330.1.120.205
Eucalyptus grandisEucgr.H02531.2.128.203Eucgr.H02531.2.128.203Eucgr.H02531.1.128.203Eucgr.H02531.1.128.203Eucgr.G02543.2.332.409
Eucgr.G02543.2.332.409Eucgr.G02543.1.332.409Eucgr.G02543.1.332.409Eucgr.H02531.2.459.539Eucgr.H02531.2.459.539
Eucgr.H02531.1.459.539Eucgr.H02531.1.459.539Eucgr.G02543.2.138.224Eucgr.G02543.2.138.224Eucgr.G02543.1.138.224
Eucgr.G02543.1.138.224
Fragaria vescamrna03581.1-v1.0-hybrid
Glycine maxGlyma08g39110.2.123.198Glyma08g39110.2.123.198Glyma08g39110.1.123.198Glyma08g39110.1.123.198Glyma18g20600.2.123.198
Glyma18g20600.2.123.198Glyma02g02450.1.313.389Glyma02g02450.1.313.389Glyma08g39110.2.452.531Glyma08g39110.2.452.531
Glyma08g39110.1.452.531Glyma08g39110.1.452.531Glyma18g20600.2.452.531Glyma18g20600.2.452.531Glyma08g40810.1.133.219
Glyma08g40810.1.133.219Glyma08g40810.1.327.403Glyma08g40810.1.327.403Glyma04g10375.2Glyma04g10375.1
Glyma02g02450.1.120.206Glyma02g02450.1.120.206
Gossypium raimondiiGorai.002G186200.7.135.210Gorai.002G186200.7.135.210Gorai.002G186200.6.121.196Gorai.002G186200.6.121.196Gorai.002G186200.5.135.210
Gorai.002G186200.5.135.210Gorai.002G186200.4.135.210Gorai.002G186200.4.135.210Gorai.002G186200.3.135.210Gorai.002G186200.3.135.210
Gorai.002G186200.2.135.210Gorai.002G186200.2.135.210Gorai.002G186200.1.136.211Gorai.002G186200.1.136.211Gorai.008G160400.2
Gorai.008G160400.1Gorai.002G186200.8Gorai.002G186200.7.465.544Gorai.002G186200.7.465.544Gorai.002G186200.6.451.530
Gorai.002G186200.6.451.530Gorai.002G186200.5.465.544Gorai.002G186200.5.465.544Gorai.002G186200.4.465.544Gorai.002G186200.4.465.544
Gorai.002G186200.3.465.544Gorai.002G186200.3.465.544Gorai.002G186200.2.465.544Gorai.002G186200.2.465.544Gorai.002G186200.1.466.545
Gorai.002G186200.1.466.545Gorai.008G182600.7Gorai.008G182600.6.125.208Gorai.008G182600.5.125.208Gorai.008G182600.4.125.208
Gorai.008G182600.3.123.206Gorai.008G182600.2.125.208Gorai.008G182600.1.125.208
Linum usitatissimumLus10013044.135.210Lus10013044.135.210Lus10029118.135.210Lus10029118.135.210Lus10036717.126.209
Lus10036717.126.209Lus10030793.133.216Lus10030793.133.216Lus10013270.136.219Lus10013270.136.219
Lus10037211.126.209Lus10037211.126.209Lus10030793.315.391Lus10030793.315.391Lus10013270.318.394
Lus10013270.318.394Lus10037211.305.381Lus10037211.305.381Lus10036717.305.381Lus10036717.305.381
Lus10029118.445.523Lus10029118.445.523Lus10013044.463.541Lus10013044.463.541Lus10032829
Malus domesticaMDP0000252405.192.267MDP0000252405.192.267MDP0000951961.54.127MDP0000951961.54.127MDP0000951961.323.402
MDP0000951961.323.402MDP0000252405.478.557MDP0000252405.478.557
Manihot esculentacassava4.1_000266m.133.208cassava4.1_000266m.133.208cassava4.1_004613m.310.386cassava4.1_004613m.310.386cassava4.1_000266m.404.482
cassava4.1_000266m.404.482cassava4.1_004613m.121.204cassava4.1_004613m.121.204cassava4.1_001555m.120.203cassava4.1_001362m.120.203
Mimulus guttatusmgv1a000186mmgv1a000185mmgv1a001104m.306.382mgv1a001104m.306.382mgv1a001104m.125.211
mgv1a001104m.125.211
Oryza sativaLOC_Os01g51754.4LOC_Os01g51754.3
Panicum virgatumPavirv00036852m.113.188Pavirv00036852m.113.188Pavirv00030888m.120.203Pavirv00030888m.120.203Pavirv00061832m.120.203
Pavirv00061832m.120.203Pavirv00036852m.456.533Pavirv00036852m.456.533Pavirv00061832m.304.382Pavirv00061832m.304.382
Pavirv00030888m.304.382Pavirv00030888m.304.382
Phaseolus vulgarisPhvul.003G062900.1.120.195Phvul.003G062900.1.120.195Phvul.002G065700.1.313.389Phvul.002G065700.1.313.389Phvul.003G062900.1.449.528
Phvul.003G062900.1.449.528Phvul.003G069200.1.132.218Phvul.003G069200.1.132.218Phvul.003G069200.1.326.402Phvul.003G069200.1.326.402
Phvul.002G065700.1.119.205Phvul.002G065700.1.119.205
Picea abiesMA_50250g0010MA_108710g0010MA_72129g0020
Populus trichocarpaPotri.010G044100.4.130.205Potri.010G044100.4.130.205Potri.010G044100.3Potri.010G044100.2Potri.010G044100.1
Potri.008G188200.2Potri.008G188200.1Potri.010G092900.9.140.223Potri.010G092900.9.140.223Potri.010G092900.8.140.223
Potri.010G092900.8.140.223Potri.010G092900.6.140.223Potri.010G092900.6.140.223Potri.010G092900.5.140.223Potri.010G092900.5.140.223
Potri.010G092900.4.140.223Potri.010G092900.4.140.223Potri.010G092900.3.140.223Potri.010G092900.3.140.223Potri.010G092900.2.140.223
Potri.010G092900.2.140.223Potri.010G092900.1.140.223Potri.010G092900.1.140.223Potri.010G092900.9.331.407Potri.010G092900.9.331.407
Potri.010G092900.8.331.407Potri.010G092900.8.331.407Potri.010G092900.6.331.407Potri.010G092900.6.331.407Potri.010G092900.5.320.396
Potri.010G092900.5.320.396Potri.010G092900.4.316.392Potri.010G092900.4.316.392Potri.010G092900.3.331.407Potri.010G092900.3.331.407
Potri.010G092900.2.327.403Potri.010G092900.2.327.403Potri.010G092900.1.331.407Potri.010G092900.1.331.407Potri.010G044100.4.469.548
Potri.010G044100.4.469.548
Prunus persicappa000209m.127.202ppa000209m.127.202ppa001575m.213.289ppa000209m.462.540ppa000209m.462.540
Ricinus communis27504.m000617.131.20627504.m000617.131.20629736.m002033.124.20729736.m002033.124.20729736.m002033.313.389
29736.m002033.313.38927504.m000617.462.54127504.m000617.462.541
Setaria italicaSi005690m.113.188Si005690m.113.188Si000308m.120.203Si000308m.120.203Si000258m.120.203
Si000258m.120.203Si005690m.456.533Si005690m.456.533Si000308m.304.382Si000308m.304.382
Si000258m.304.382Si000258m.304.382
Sorghum bicolorSb10g017820.1.117.192Sb10g017820.1.117.192Sb03g032830.1.58.143Sb03g032830.1.58.143Sb10g017820.1.460.537
Sb10g017820.1.460.537Sb03g032830.1.241.319Sb03g032830.1.241.319
Thellungiella halophilaThhalv10006578mThhalv10006565mThhalv10018099m.133.216Thhalv10018099m.133.216Thhalv10018099m.318.394
Thhalv10018099m.318.394Thhalv10024230m
Vitis viniferaGSVIVT01013806001GSVIVT01020069001.305.381GSVIVT01020069001.305.381GSVIVT01020069001.117.203GSVIVT01020069001.117.203
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)