y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G305300.12
FamilyGH13
Protein PropertiesLength: 737 Molecular Weight: 81776.4 Isoelectric Point: 6.1191
ChromosomeChromosome/Scaffold: 09 Start: 27672685 End: 27683124
Descriptionlimit dextrinase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133585954e-24
  AGVLHLKKLSKAGITHVHLLPTFQFAAVDDEKENWKYVDSKILEKLPSDSAEQQEKITAIQDDDAYNWGYNPVLWGVPKGSYSSDPNGPCRIVEFRKMIQ
  ALTHIGLRVVLDVVYNHLHANGPFDKDSVLDKIVPGYYLRRNTDGFIENSTCVNNTASEHYMVERLIIDDLLSWAINYKVDGFRFDLMGHIMKRTMVKAK
  DALCSLTKERDGVDGSRIYIYGEGWDFGEVAKNGRGIN
Full Sequence
Protein Sequence     Length: 737     Download
MVDVLRVPFP VLQSSPSLSF KPRLCPLIPP SRRLHLKSNS LLFPLFCSSP SFFKLPLRCS    60
SSSMPLQLSS LSQDSLLYSR AYWVTKTIIA WNVDVVEGSC YLYASKVAAL SVTDNGIQGH    120
DLEIKLEEDR SGLPPNVIEK FPHIRDYRAF KLPPVLDAKN LVKCQLAVAE FNSQGKCRNA    180
TGLQLPGVLD ELFSYDGPLG AFYSAEAVSL CLWAPTAQAV YAHIYKDPVG GCPLEIIPLE    240
ETNGVWSTKG PKSWEGCYYM YEVSVYHPST LHIEKCYAND PYARGLSADG KRTLFVNLHA    300
DDLKPEGWDE LEDMKPDILS FSDISIYELH IRDFSANDDT VNADFRGGYM AFTLKDSAGV    360
LHLKKLSKAG ITHVHLLPTF QFAAVDDEKE NWKYVDSKIL EKLPSDSAEQ QEKITAIQDD    420
DAYNWGYNPV LWGVPKGSYS SDPNGPCRIV EFRKMIQALT HIGLRVVLDV VYNHLHANGP    480
FDKDSVLDKI VPGYYLRRNT DGFIENSTCV NNTASEHYMV ERLIIDDLLS WAINYKVDGF    540
RFDLMGHIMK RTMVKAKDAL CSLTKERDGV DGSRIYIYGE GWDFGEVAKN GRGINASQFN    600
LCGTGIGSFN DRIRDAMLGG SPFGPPLQQG FVTGLLLEPN GHDHGTKDVE KAMLASAKDH    660
IQVGLAANLR GFVLTDFEGK ERKGSEVLCY GGTPVGYAFC PTETVLILLS ENTLLRFNVP    720
GFVLKVCTLL SGVKFS*                                                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1523PulA1.0e-76191631453+
TIGR02104pulA_typeI3.0e-109190656483+
cd11341AmyAc_Pullulanase_LD-like3.0e-120323676364+
PLN02877PLN02877080705626+
TIGR02103pullul_strch080705661+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI31395.103571923719unnamed protein product [Vitis vinifera]
RefSeqNP_196056.207471983728ATLDA (LIMIT DEXTRINASE); alpha-amylase/ limit dextrinase/ pullulanase [Arabidopsis thaliana]
RefSeqXP_002271820.107371924670PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315334.10647191658predicted protein [Populus trichocarpa]
RefSeqXP_002532780.105371958729pullulanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4aio_A0797196648A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2y5e_A0797196648A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2y4s_A0797196648A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhf_A081705179827A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhc_A081705179827A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1283442883906770
EL4526952703105790
DT7301142752244980
EH7173812652905540
GR0884312493886360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00024.1
Arabidopsis lyrata487216
Arabidopsis thalianaAT5G04360.1
Brachypodium distachyonBradi5g00540.2Bradi5g00540.1
Brassica rapaBra009461
Carica papayaevm.model.supercontig_53.158
Capsella rubellaCarubv10000153m
Chlamydomonas reinhardtiiCre11.g476650.t1.3
Citrus clementinaCiclev10031035m
Citrus sinensisorange1.1g002079morange1.1g002161morange1.1g002787m
Cucumis sativusCucsa.308730.1
Eucalyptus grandisEucgr.G02746.1Eucgr.G02746.2
Fragaria vescamrna23425.1-v1.0-hybrid
Glycine maxGlyma10g34080.1
Gossypium raimondiiGorai.009G305300.11Gorai.009G305300.1Gorai.009G305300.10Gorai.009G305300.2Gorai.009G305300.3
Gorai.009G305300.4Gorai.009G305300.5Gorai.009G305300.6Gorai.009G305300.7Gorai.009G305300.9
Gorai.009G305300.8
Linum usitatissimumLus10038675
Malus domesticaMDP0000142103
Manihot esculentacassava4.1_004771m
Mimulus guttatusmgv1a001246m
Physcomitrella patensPp1s142_79V6.1.481.888
Phaseolus vulgarisPhvul.007G139400.1
Populus trichocarpaPotri.010G229300.4Potri.010G229300.1Potri.010G229300.2Potri.010G229300.3
Prunus persicappa000905m
Ricinus communis29475.m000230
Setaria italicaSi011852m
Selaginella moellendorffii165275
Sorghum bicolorSb06g001540.1
Thellungiella halophilaThhalv10012585m
Vitis viniferaGSVIVT01016183001
Volvox carteriVocar20014607m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny