y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G279200.1
FamilyGH17
Protein PropertiesLength: 375 Molecular Weight: 41449.9 Isoelectric Point: 6.2567
ChromosomeChromosome/Scaffold: 11 Start: 61125304 End: 61126564
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17233490
  IGVTYSTTTTTASPPPDKISATISTLKIPNVRLPDADPSLIKAFAFTNTSLFLSIPNPLLPAVAANRSLALRWLYRHVLPFYPRSKITLISVGNAVLDSV
  AEQDFTPYLLPAMRNLHLALHELGIKKIPVSTTFSFFSTITTAFPPSSAEFQQPAGDLIIKPLLQFLEETNSSFLINLYPYNLYRLNSEIPVGFALFQDY
  PFNFRDDLVTGVRYFNLFDMMADSVLTAMAVMGYESVPVIVAETGWPSGGGEAGEVEANEAYAEMYLKGLVRHLKSGVGTPLKKDGVAEVYVYELMDHEG
  GNNDNNKVKGRKWGILTENMTRKFNVE
Full Sequence
Protein Sequence     Length: 375     Download
MPSFLFISLL LSFIHFSFSL PSIGVTYSTT TTTASPPPDK ISATISTLKI PNVRLPDADP    60
SLIKAFAFTN TSLFLSIPNP LLPAVAANRS LALRWLYRHV LPFYPRSKIT LISVGNAVLD    120
SVAEQDFTPY LLPAMRNLHL ALHELGIKKI PVSTTFSFFS TITTAFPPSS AEFQQPAGDL    180
IIKPLLQFLE ETNSSFLINL YPYNLYRLNS EIPVGFALFQ DYPFNFRDDL VTGVRYFNLF    240
DMMADSVLTA MAVMGYESVP VIVAETGWPS GGGEAGEVEA NEAYAEMYLK GLVRHLKSGV    300
GTPLKKDGVA EVYVYELMDH EGGNNDNNKV KGRKWGILTE NMTRKFNVEI SSGVKNYGLM    360
GIFLFLIAIF YAFP*                                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_179.0e-4823348329+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71832.101931428323hypothetical protein [Vitis vinifera]
RefSeqNP_191137.102337331380glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002276218.101935528360PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316237.103937162390predicted protein [Populus trichocarpa]
RefSeqXP_002530412.102235233358Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A1e-39233321292A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B3e-37233491305A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A3e-37233491305A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghr_A2e-35233461302A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aq0_B2e-35233461302A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Transmembrane Domains
StartEnd
426
351373
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY304294217392550
CK292904243222620
FC904856187392250
DT7368282271283540
DR9338112231323540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00773.1
Arabidopsis lyrata486019
Arabidopsis thalianaAT3G55780.1
Brassica rapaBra003281Bra007190
Carica papayaevm.model.supercontig_19.225
Capsella rubellaCarubv10018761m
Citrus clementinaCiclev10033928m
Citrus sinensisorange1.1g035682m
Cucumis sativusCucsa.164630.1
Eucalyptus grandisEucgr.F04056.1
Fragaria vescamrna20901.1-v1.0-hybrid
Glycine maxGlyma02g42110.2
Gossypium raimondiiGorai.013G019700.1
Linum usitatissimumLus10028258Lus10040232
Malus domesticaMDP0000873928MDP0000878409
Manihot esculentacassava4.1_021110m
Medicago truncatulaMedtr5g081720.1
Mimulus guttatusmgv1a007581m
Phaseolus vulgarisPhvul.008G227100.1
Populus trichocarpaPotri.010G193700.1
Prunus persicappa021891m
Ricinus communis29610.m000404
Thellungiella halophilaThhalv10006375mThhalv10005331mThhalv10006480mThhalv10010910m
Vitis viniferaGSVIVT01016379001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny