y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G008800.1
FamilyGH13
Protein PropertiesLength: 790 Molecular Weight: 89035.4 Isoelectric Point: 5.9536
ChromosomeChromosome/Scaffold: 12 Start: 928430 End: 950293
Descriptionisoamylase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132426280
  KFPGTYCGVVEKLDHLKELGVNCIELMPCHEFNELEYYSYNSVLGDYKLNFWGYSTINYFSPMIRYSSSGIRSCGRDAINEFKYLVKEAHKRGIEVIMDV
  VFNHTAEGNEKGLSVSFRGVDNCVYYMLAPKGEYYNYSGCGNTFNCNHPVVRQFILDCLRYWVAEMHVDGFRFDLASIMTRSSSLWDSVNVYGDPLEGDL
  ITTGTPLSNPPLIDMMSNDPVLHGVKLIAEAWDAGGLYQVGRFPHWGVWSEWNGKYRDIVRQFIKGTDGLSGAFAECLCGSPNLYQKGGGKPWNSVNFIC
  AHDGFTLADLVTYNNKHNLANGEDNNDGESHNYSWNCGQEGEFASISVKKLRKRQMRNFFLCLMVSQGVPMIHMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 790     Download
MDLIRCTSCF QHSPTLIAPT FRHRTTPKPN LTTISNNHAT VSTTRMVVKA RGGGAAEAET    60
ALVDKPKVLK RFQVSDGHPA PFGATIQDGG VNFAIYSANA TSATLCLIAL SDLQQNRVTE    120
QIPLDPLANK TGDVWHVFLK GNFKDMLYGY IFDGEFSPEI GHYYDSSRIL LDPYAKAVIS    180
RGEFGALGPE DNCWPQMAGM VPTSEDQFDW EGDLPLRHPG RDLIIYEMHV RGYTRHESSG    240
TKFPGTYCGV VEKLDHLKEL GVNCIELMPC HEFNELEYYS YNSVLGDYKL NFWGYSTINY    300
FSPMIRYSSS GIRSCGRDAI NEFKYLVKEA HKRGIEVIMD VVFNHTAEGN EKGLSVSFRG    360
VDNCVYYMLA PKGEYYNYSG CGNTFNCNHP VVRQFILDCL RYWVAEMHVD GFRFDLASIM    420
TRSSSLWDSV NVYGDPLEGD LITTGTPLSN PPLIDMMSND PVLHGVKLIA EAWDAGGLYQ    480
VGRFPHWGVW SEWNGKYRDI VRQFIKGTDG LSGAFAECLC GSPNLYQKGG GKPWNSVNFI    540
CAHDGFTLAD LVTYNNKHNL ANGEDNNDGE SHNYSWNCGQ EGEFASISVK KLRKRQMRNF    600
FLCLMVSQGV PMIHMGDEYG HTKGGNNNTY CHDNYINYFR WDKKEESASD LFRFFCLMTM    660
FRRECESLGL NDFPTAERLQ WHGHTPGKPD WSDTSRFVAF TLIDSVKGEI YVAFNTSHLP    720
VTITLPDRPG YRWEPLVDTS KPAPFDFLSN EVPERDLAIK QYAHFLDANL YPMLSYSSIV    780
LLLSPDENA*                                                           840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145102.0e-13969730696+
PRK03705PRK037057.0e-16173668612+
cd11326AmyAc_Glg_debranch0208664462+
COG1523PulA073759716+
TIGR02100glgX_debranch076745712+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN15317.1017891793isoamylase isoform 1 [Solanum tuberosum]
DDBJBAF52941.1097893791isoamylase-type starch-debranching enzyme 1 [Phaseolus vulgaris]
EMBLCBI40669.10178911809unnamed protein product [Vitis vinifera]
RefSeqXP_002308090.10178811825predicted protein [Populus trichocarpa]
RefSeqXP_002324659.1017891794predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B07771015647A Chain A, Bacillus Subtilis Pectate Lyase
PDB2vuy_A07771015647A Chain A, Bacillus Subtilis Pectate Lyase
PDB2vr5_B07771015647A Chain A, Bacillus Subtilis Pectate Lyase
PDB2vr5_A07771015647A Chain A, Bacillus Subtilis Pectate Lyase
PDB2vnc_B07771015647A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002352654847480
HO8002351193104280
HO800235584254820
CO1167002874147000
HO4312284193637810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)