y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G095700.1
FamilyGH33
Protein PropertiesLength: 337 Molecular Weight: 37543 Isoelectric Point: 9.1891
ChromosomeChromosome/Scaffold: 12 Start: 17628888 End: 17631244
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33373252.1e-28
  SAPFNSCRASTIVEVSKGPFLVAYYGGTSEGAPDVKIWLQTMGGRWYTPIVMDEEPNVPMWNPVLFKLPSDELLLFYKVGLDVQKWSGCMKRSYDKGVTW
  TQREQLPPGILGPSKNKPLLLRNGNLLFGSSVESWNSWGAWAEVTPDSGRTWKKYGPIYVKSQVLSVIQPVPYLTAKGHLRLLMRSFNNISRVCMAESFD
  GGQGWGYAIPTELPNPNSGIDGVKLRDGRLLLAYNTISRGVLKVSLSKDDGDSWQDSLTLEETQGMEFSYPAVIQASDGLVHITYTYNR
Full Sequence
Protein Sequence     Length: 337     Download
MCRYTKGTTS SPESLHKKRH LPIKGPLKEE FTFPACSAPF NSCRASTIVE VSKGPFLVAY    60
YGGTSEGAPD VKIWLQTMGG RWYTPIVMDE EPNVPMWNPV LFKLPSDELL LFYKVGLDVQ    120
KWSGCMKRSY DKGVTWTQRE QLPPGILGPS KNKPLLLRNG NLLFGSSVES WNSWGAWAEV    180
TPDSGRTWKK YGPIYVKSQV LSVIQPVPYL TAKGHLRLLM RSFNNISRVC MAESFDGGQG    240
WGYAIPTELP NPNSGIDGVK LRDGRLLLAY NTISRGVLKV SLSKDDGDSW QDSLTLEETQ    300
GMEFSYPAVI QASDGLVHIT YTYNRTQIKH VVVQPN*                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00260Sialidase0.000279292251+
COG4692COG46922.0e-2439335350+
pfam13088BNR_24.0e-8954319282+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18568.101033627354unknown [Glycine max]
RefSeqNP_851204.102733414322BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqXP_002263578.102333655369PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324495.102733611321predicted protein [Populus trichocarpa]
RefSeqXP_002531744.10183362321conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL689016287353200
DV137355268563220
CV274814246903350
DV145816255533060
EY114510258262820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.010G053100.5Gorai.010G053100.4
Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny