y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G019700.1
FamilyGH17
Protein PropertiesLength: 384 Molecular Weight: 41843.4 Isoelectric Point: 7.6894
ChromosomeChromosome/Scaffold: 13 Start: 1370339 End: 1371740
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17233470
  IGITYSSTVSPPPPPLPAKVSSLISALKITSVRLPDPDPSLIKAFAPTNTSLFLSISNSHLPALASNGSVALSWLRRHVLPFYPRSKICLISVGNTVLDS
  TTIQDFSPFLLPATRNLHHALQELGINKIQISATFSFFSTITTAFPPSSAVFQQPAGDLIIKPLLQFLEQTNSSFLINIYPYNLFRLNSEIPIGFALFQD
  NLFNFRDDPVTGIRYFNLFAMMADAVLTAMAAMGYQNIPVVVAETGWPSGGSQAEEVEANGVYAEMYLKGLVRHLKSGAATPLKKDGVAEVYVYELMDHG
  GGNNERGRKWGILTENMTMKYNVEF
Full Sequence
Protein Sequence     Length: 384     Download
MASFLFLSVL FSFLHFTSSI PSIGITYSST VSPPPPPLPA KVSSLISALK ITSVRLPDPD    60
PSLIKAFAPT NTSLFLSISN SHLPALASNG SVALSWLRRH VLPFYPRSKI CLISVGNTVL    120
DSTTIQDFSP FLLPATRNLH HALQELGINK IQISATFSFF STITTAFPPS SAVFQQPAGD    180
LIIKPLLQFL EQTNSSFLIN IYPYNLFRLN SEIPIGFALF QDNLFNFRDD PVTGIRYFNL    240
FAMMADAVLT AMAAMGYQNI PVVVAETGWP SGGSQAEEVE ANGVYAEMYL KGLVRHLKSG    300
AATPLKKDGV AEVYVYELMD HGGGNNERGR KWGILTENMT MKYNVEFSSG AKNSGICLVA    360
IWLTNWLLIT SMNLILGFIG VQG*                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_178.0e-5623347328+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT40508.102736839394Glycosyl hydrolases family 17 protein [Solanum demissum]
RefSeqNP_191137.102335231358glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002276218.101736326382PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316237.104136863386predicted protein [Populus trichocarpa]
RefSeqXP_002530412.102235133360Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A4.99997e-41233471312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_B2e-37233483315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_A2e-37233483315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur7_B2e-37233483315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A2e-37233483315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Transmembrane Domains
StartEnd
359381
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT7368282481293730
DR9338112441333730
DY304294244212560
HO840922237743000
DR9305692031743730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00773.1
Arabidopsis lyrata486019
Arabidopsis thalianaAT3G55780.1
Brassica rapaBra003281Bra007190
Carica papayaevm.model.supercontig_19.225
Capsella rubellaCarubv10018761m
Citrus clementinaCiclev10033928m
Citrus sinensisorange1.1g035682m
Cucumis sativusCucsa.164630.1
Eucalyptus grandisEucgr.F04056.1
Fragaria vescamrna20901.1-v1.0-hybrid
Glycine maxGlyma02g42110.2
Gossypium raimondiiGorai.011G279200.1
Linum usitatissimumLus10028258Lus10040232
Malus domesticaMDP0000873928MDP0000878409
Manihot esculentacassava4.1_021110m
Medicago truncatulaMedtr5g081720.1
Mimulus guttatusmgv1a007581m
Phaseolus vulgarisPhvul.008G227100.1
Populus trichocarpaPotri.010G193700.1
Prunus persicappa021891m
Ricinus communis29610.m000404
Thellungiella halophilaThhalv10006375mThhalv10005331mThhalv10006480mThhalv10010910m
Vitis viniferaGSVIVT01016379001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny