y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.TU.contig_28540.1
FamilyGH35
Protein PropertiesLength: 139 Molecular Weight: 16039.6 Isoelectric Point: 9.0371
ChromosomeChromosome/Scaffold: 28540 Start: 97 End: 961
Descriptionbeta-galactosidase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3561290
  IIISGAIHYPRSTPQMWPDLIQKAKDGGLDAIETYIFWNIHEPRRRQYNFTGNLDFVKFFKLTHQAGLYGILRIGPYACAEWNFGGFPVWLKNMPGIELR
  TNNEIYKNEMKIFTTKIVNICKDA
Full Sequence
Protein Sequence     Length: 139     Download
MVTTGIIISG AIHYPRSTPQ MWPDLIQKAK DGGLDAIETY IFWNIHEPRR RQYNFTGNLD    60
FVKFFKLTHQ AGLYGILRIG PYACAEWNFG GFPVWLKNMP GIELRTNNEI YKNEMKIFTT    120
KIVNICKDAI YLPHKEDL*                                                 180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_420.0002139685+
COG1874LacA5.0e-166123129+
PLN03059PLN030593.0e-596127122+
pfam01301Glyco_hydro_355.0e-696128123+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ09953.10612740162beta-galactosidase [Mangifera indica]
RefSeqXP_002326135.10612945168predicted protein [Populus trichocarpa]
RefSeqXP_002516237.10612740161beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002516256.10612862184beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002528629.10612922145beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A2e-25612823145A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D8e-25811128131A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C8e-25811128131A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_B8e-25811128131A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_A8e-25811128131A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC88417212461290
DB96238212461290
DB96217412461290
FK00063312461290
DY28009712461290
Orthologous Group
SpeciesID
Brassica rapaBra008306
Carica papayaevm.model.supercontig_28.7
Cucumis sativusCucsa.155220.1Cucsa.374340.1
Linum usitatissimumLus10025108.29.144Lus10005070.37.184Lus10005070.37.184Lus10025110.33.156Lus10025110.33.156
Lus10025108.29.144Lus10025108.29.144Lus10020877.21.135Lus10020877.21.135
Malus domesticaMDP0000206653MDP0000275455
Phaseolus vulgarisPhvul.009G225100.1.36.150Phvul.009G225100.1.36.150
Picea abiesMA_10430283g0010MA_19375g0010MA_329922g0010
Ricinus communis59437.m0000529739.m003719.32.14629739.m003719.32.146
Vitis viniferaGSVIVT01006709001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny