y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_157.32
FamilyCBM43
Protein PropertiesLength: 469 Molecular Weight: 51854.3 Isoelectric Point: 6.5209
ChromosomeChromosome/Scaffold: 157 Start: 240284 End: 241979
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433804597.2e-27
  WCVVVKGADVKELGSALDYACGEGEESCAALAPGKECYEPVSVTWHASYAFSSYWAQMRSRGANCYFNGLAEQTDEDPSK
GH17293530
  IGINYGRLGNNLPPPIQTIELIKSLKAGRVKLYDSNPEILNLLSATQIQVSIMVPNHQIIPISLNQNFADQWVQDNILTYYPETKIRIVLVGNEVLSYSA
  SDQDREIWYHLVPAMRRINKSMKAQGIKNIKVGTPLAMDVLSSTFPPSNGAFRSDIVDTVIIPLLHFLNGSNSFFFVDAYPYFPWSMNPTRANLDFALFK
  SNRTYTDPISGLKYTNLLDQMLDSVVFATAKLGYPSIRISISETGWPNAGDIDQVGANLQNAAVFNRNLIKKITADPPLGTPARPGEEIPTFIFSLFNEN
  QKSGPGTERHWGLLYPNGTHIYEVD
Full Sequence
Protein Sequence     Length: 469     Download
MPKLSSIDMG LALFLFSLLL VFSKASSKIG INYGRLGNNL PPPIQTIELI KSLKAGRVKL    60
YDSNPEILNL LSATQIQVSI MVPNHQIIPI SLNQNFADQW VQDNILTYYP ETKIRIVLVG    120
NEVLSYSASD QDREIWYHLV PAMRRINKSM KAQGIKNIKV GTPLAMDVLS STFPPSNGAF    180
RSDIVDTVII PLLHFLNGSN SFFFVDAYPY FPWSMNPTRA NLDFALFKSN RTYTDPISGL    240
KYTNLLDQML DSVVFATAKL GYPSIRISIS ETGWPNAGDI DQVGANLQNA AVFNRNLIKK    300
ITADPPLGTP ARPGEEIPTF IFSLFNENQK SGPGTERHWG LLYPNGTHIY EVDLTGKKET    360
REYQPLPAAK NDVPYKGKLW CVVVKGADVK ELGSALDYAC GEGEESCAAL APGKECYEPV    420
SVTWHASYAF SSYWAQMRSR GANCYFNGLA EQTDEDPSKA VEIAVSQV*                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X82.0e-1837945077+
smart00768X86.0e-3037945880+
pfam00332Glyco_hydro_177.0e-11429353326+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM64490.102645734464beta-1,3-glucanase, putative [Arabidopsis thaliana]
GenBankABK28569.102645734464unknown [Arabidopsis thaliana]
EMBLCBI39470.1074585456unnamed protein product [Vitis vinifera]
RefSeqNP_189019.102645734464glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002298669.102846022453predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0293541312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0293541306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0293541306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3ur8_B0293553315A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3ur8_A0293553315A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX0505502781494260
EX0504612721794500
EX0515792751834570
DT5722513061134170
EX2913573401044410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)