y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_216.21
FamilyGH35
Protein PropertiesLength: 846 Molecular Weight: 92235.5 Isoelectric Point: 7.5545
ChromosomeChromosome/Scaffold: 216 Start: 200256 End: 208448
Descriptionbeta-galactosidase 8
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35343370
  LVIDGKRRVLISGSIHYPRSTPEMWADLIQKSKDGGLDVIETYVFWNIHEPVRNQYNFEGRNDLVKFVKLVAEAGLYVHLRIGPYVCAEWNYGGFPLWLH
  FMPGIEFRTDNGPFKAEMQRFTTKIVGMMKDEKLYASQGGPIILSQIENEYGNIDSSYGAAGKTYMKWAANMAISLDTGVPWVMCQQRDAPDPIINTCNG
  FYCDQFTPNSKTKPMMWTENWSGWFLSFGGRVPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRTTGGPFISTSYDYDAPIDEYGLIRQPKWGQLK
  ELHK
Full Sequence
Protein Sequence     Length: 846     Download
MRGDVILLIV SCLAIGILAR TSFGATVTYD QRALVIDGKR RVLISGSIHY PRSTPEMWAD    60
LIQKSKDGGL DVIETYVFWN IHEPVRNQYN FEGRNDLVKF VKLVAEAGLY VHLRIGPYVC    120
AEWNYGGFPL WLHFMPGIEF RTDNGPFKAE MQRFTTKIVG MMKDEKLYAS QGGPIILSQI    180
ENEYGNIDSS YGAAGKTYMK WAANMAISLD TGVPWVMCQQ RDAPDPIINT CNGFYCDQFT    240
PNSKTKPMMW TENWSGWFLS FGGRVPYRPV EDLAFAVARF YQRGGTFQNY YMYHGGTNFG    300
RTTGGPFIST SYDYDAPIDE YGLIRQPKWG QLKELHKAIK LCESALVATA PTITSLGQNL    360
EAAVYKTGSI CAAFLANVGT QSDANVTFNG NSYFVPAWSV SILPDCKSVV LNTAKINSVT    420
EIPRFTLQSL NIDADSPETL GSQWSWINEP VGISRKDAFS KPGLLEQINT TADKSDYLWY    480
SISTDIKSDE PLLKDESHTV LHVESLGHAL HAFINGKLAG SGTGSSNNAK VSVKIPVTLQ    540
PGKNTIDLLS LTVGLQNYGA FFDKVGAGIT GPVKLEGSNG ASIDLSSQQW TYQVGLKGEE    600
LGLSTGSSSG WVSQPTLPVK QPLIWYKTKF DAPAGSSPVA LDFTGMGKGE AWVNGQSIGR    660
YWPTNIAPGS GCTDSCNYRG SYSSNKCLKN CGKPSQSLYH VPRSWLQASG NTLVLFEEIG    720
GNPSEIQIAT RQTESLCSYI SESHPSPVDM WNSDSEKARK SGPMLLLECP SPSQVISSIK    780
FASFGTPRGT CGSFKHSKCN SSHAHSIVQK ACLGSRSCSI SVSTDVFGNP CRGVLKSLAV    840
EASCT*                                                               900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_425.0e-749204172+
COG1874LacA4.0e-2327329367+
pfam02140Gal_Lectin2.0e-2476784481+
pfam01301Glyco_hydro_352.0e-16933339322+
PLN03059PLN0305905845845+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD91083.101984414841beta-D-galactosidase [Pyrus pyrifolia]
EMBLCAC44501.101984422839beta-galactosidase [Fragaria x ananassa]
EMBLCBI16297.1018451846unnamed protein product [Vitis vinifera]
RefSeqXP_002314274.101884423848predicted protein [Populus trichocarpa]
RefSeqXP_002530296.1078456842beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A0253356325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.0003495727395582A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D3e-382736111357A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C3e-382736111357A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77816073787380
HO780602671777310
HO7955525311176430
HO7955526613780
HO79555240781170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00780.9Aquca_001_00780.8Aquca_001_00780.7Aquca_001_00780.6Aquca_001_00780.5
Aquca_001_00780.4Aquca_001_00780.3Aquca_001_00780.2Aquca_001_00780.1Aquca_034_00110.4
Aquca_034_00110.3Aquca_034_00110.1Aquca_020_00465.4Aquca_020_00465.3Aquca_020_00465.2
Aquca_020_00465.1Aquca_010_00597.2Aquca_010_00597.1Aquca_001_00069.5Aquca_001_00069.4
Aquca_001_00069.3Aquca_001_00069.2Aquca_001_00069.1Aquca_007_00320.5Aquca_007_00320.4
Aquca_007_00320.3Aquca_007_00320.2Aquca_007_00320.1Aquca_014_00261.6Aquca_014_00261.5
Aquca_014_00261.3Aquca_014_00261.1Aquca_076_00042.1Aquca_014_00261.2
Arabidopsis lyrata481656902346897617491000485655
313754351167492198473836885868
919677
Arabidopsis thalianaAT2G28470.2AT2G28470.1AT2G32810.2AT2G32810.1AT3G13750.1
AT4G36360.2AT4G36360.1AT3G52840.1AT1G45130.1AT5G20710.1
AT4G26140.2AT4G26140.1AT1G31740.1AT5G56870.1AT5G63810.1
Brachypodium distachyonBradi1g67760.1Bradi4g07990.3Bradi4g07990.2Bradi4g07990.1Bradi3g08180.1
Bradi1g74050.1Bradi1g37450.1Bradi2g41830.1Bradi2g56607.1Bradi2g40450.1
Bradi3g49460.1
Brassica rapaBra011946Bra000493Bra021814Bra027403Bra011677
Bra036334Bra002325Bra006850Bra021506Bra019644
Bra035634Bra014036Bra019120Bra024238
Carica papayaevm.model.supercontig_25.57evm.model.supercontig_93.34evm.TU.contig_32583.1evm.model.supercontig_6.189evm.model.supercontig_28.1
evm.model.supercontig_99.11evm.model.supercontig_24.26evm.model.supercontig_28.48evm.model.supercontig_18.155evm.model.supercontig_37.20
Capsella rubellaCarubv10025350mCarubv10025536mCarubv10011312mCarubv10016323mCarubv10004155m
Carubv10004117mCarubv10008424mCarubv10007108mCarubv10003630mCarubv10025963m
Carubv10025947m
Citrus clementinaCiclev10027805mCiclev10004268mCiclev10024888mCiclev10024886mCiclev10000260m
Ciclev10017808mCiclev10024881mCiclev10007628mCiclev10007573mCiclev10007531m
Ciclev10010771mCiclev10010541mCiclev10030257mCiclev10010454mCiclev10010258m
Ciclev10000393mCiclev10018839m
Citrus sinensisorange1.1g009890morange1.1g006249morange1.1g003147morange1.1g003095morange1.1g038226m
orange1.1g005416morange1.1g003498morange1.1g003137morange1.1g002867morange1.1g006635m
orange1.1g004777morange1.1g003649morange1.1g003585morange1.1g003076morange1.1g037925m
orange1.1g006904morange1.1g003490morange1.1g003044morange1.1g007390morange1.1g007388m
orange1.1g006681morange1.1g006349morange1.1g005319morange1.1g005182morange1.1g004677m
orange1.1g004219morange1.1g039348morange1.1g046585morange1.1g005160morange1.1g005690m
orange1.1g037832morange1.1g004525morange1.1g036343morange1.1g045354morange1.1g004605m
orange1.1g046146m
Cucumis sativusCucsa.256570.1Cucsa.207240.3Cucsa.207240.2Cucsa.207240.1Cucsa.043260.3
Cucsa.043260.1Cucsa.397370.7Cucsa.397370.6Cucsa.397370.4Cucsa.397370.3
Cucsa.397370.2Cucsa.201100.1Cucsa.229010.3Cucsa.229010.1Cucsa.397370.5
Cucsa.397380.7Cucsa.397380.4Cucsa.397380.3Cucsa.397380.2Cucsa.397380.1
Cucsa.014950.1Cucsa.228210.1Cucsa.182050.1Cucsa.342700.5Cucsa.342700.3
Cucsa.342700.2Cucsa.342700.1Cucsa.356120.1Cucsa.254230.1Cucsa.397400.1
Cucsa.043260.2Cucsa.141960.1Cucsa.109300.1Cucsa.397370.1Cucsa.128820.1
Eucalyptus grandisEucgr.J00936.1Eucgr.F01855.1Eucgr.H00038.1Eucgr.D00703.2Eucgr.D00703.1
Eucgr.C00898.2Eucgr.C00898.1Eucgr.I02384.1Eucgr.C03662.1Eucgr.G01704.2
Eucgr.G01704.1Eucgr.F03130.2Eucgr.F03130.1Eucgr.J02867.4Eucgr.J02867.3
Eucgr.J02867.2Eucgr.J02867.1Eucgr.C03896.1Eucgr.A01583.1Eucgr.C03897.1
Eucgr.I00108.1Eucgr.C03898.1Eucgr.C00782.1
Fragaria vescamrna04817.1-v1.0-hybridmrna14907.1-v1.0-hybridmrna23065.1-v1.0-hybridmrna21868.1-v1.0-hybridmrna12627.1-v1.0-hybrid
mrna12626.1-v1.0-hybridmrna30476.1-v1.0-hybridmrna12914.1-v1.0-hybridmrna24562.1-v1.0-hybridmrna12920.1-v1.0-hybrid
Glycine maxGlyma08g11670.1Glyma13g40200.2Glyma13g40200.1Glyma11g20730.1Glyma12g29660.1
Glyma11g16010.1Glyma08g20650.1Glyma15g02750.1Glyma07g01250.1Glyma13g42680.1
Glyma04g03120.1Glyma01g37541.1Glyma11g07760.1Glyma14g07700.1Glyma17g37270.3
Glyma17g37270.2Glyma02g05790.1Glyma02g07770.1Glyma16g24440.1Glyma02g07740.1
Glyma13g17240.1Glyma17g06280.1Glyma09g07100.1Glyma09g21970.1Glyma15g18430.5
Glyma15g18430.4Glyma15g18430.2Glyma17g05250.1Glyma16g09490.1Glyma07g12010.1
Glyma07g12060.1Glyma04g38590.1Glyma06g16420.2Glyma06g03160.1Glyma16g05320.2
Gossypium raimondiiGorai.009G078400.2Gorai.009G078400.1Gorai.011G155500.3Gorai.011G155500.2Gorai.011G155500.1
Gorai.009G140800.1Gorai.001G011600.3Gorai.001G011600.2Gorai.001G011600.1Gorai.010G007300.4
Gorai.010G007300.3Gorai.010G007300.2Gorai.010G007300.1Gorai.009G198100.2Gorai.009G198100.1
Gorai.011G065300.3Gorai.011G065300.2Gorai.011G065300.1Gorai.003G011900.1Gorai.010G082900.7
Gorai.010G082900.6Gorai.010G082900.5Gorai.010G082900.4Gorai.010G082900.3Gorai.010G082900.2
Gorai.010G082900.1Gorai.011G021800.1Gorai.007G198900.7Gorai.007G198900.6Gorai.007G198900.5
Gorai.007G198900.4Gorai.007G198900.3Gorai.007G198900.2Gorai.007G198900.1Gorai.005G246600.4
Gorai.005G246600.3Gorai.005G246600.2Gorai.005G246600.1Gorai.008G000600.3Gorai.008G000600.2
Gorai.008G000600.1Gorai.009G140800.2Gorai.013G222800.1Gorai.011G065300.4Gorai.003G059500.1
Gorai.013G216400.1Gorai.013G261500.1Gorai.008G221000.1
Linum usitatissimumLus10016655Lus10015625Lus10037644Lus10000701Lus10025980
Lus10024292Lus10041798Lus10028348Lus10040557Lus10006009
Lus10028848Lus10008974.310.612Lus10008974.310.612Lus10008974.310.612Lus10006733
Lus10000803Lus10014278Lus10022645Lus10003343Lus10025108.641.935
Lus10025108.641.935Lus10025108.641.935
Malus domesticaMDP0000271897MDP0000265046MDP0000030527MDP0000151981MDP0000416548
MDP0000188563MDP0000899966MDP0000310582MDP0000227393MDP0000201058
MDP0000195063MDP0000133794MDP0000180588MDP0000202465
Manihot esculentacassava4.1_031695mcassava4.1_001639mcassava4.1_001637mcassava4.1_001503mcassava4.1_021365m
cassava4.1_001635mcassava4.1_001624mcassava4.1_001621mcassava4.1_003430mcassava4.1_001885m
cassava4.1_001652mcassava4.1_002442mcassava4.1_031472mcassava4.1_021879mcassava4.1_023022m
cassava4.1_001733mcassava4.1_029381mcassava4.1_025948m
Medicago truncatulaMedtr2g094060.1Medtr2g094070.1Medtr4g059680.1Medtr8g085210.1Medtr2g100110.1
Medtr2g094020.1Medtr1g023120.1Medtr5g021190.1Medtr2g039120.2Medtr2g039120.1
Medtr5g024080.1Medtr2g042610.1Medtr3g005570.1Medtr1g018200.1Medtr3g096900.2
Medtr3g096900.1Medtr5g025830.1
Mimulus guttatusmgv1a001399mmgv1a001263mmgv1a001990mmgv1a001293mmgv1a001258m
mgv1a001958mmgv1a001956mmgv1a001295mmgv1a003101mmgv1a001274m
mgv1a001299mmgv1a024117mmgv1a001416mmgv1a026608mmgv1a001605m
mgv1a001631mmgv1a001413mmgv1a001532m
Oryza sativaLOC_Os03g15020.1LOC_Os12g24170.1LOC_Os06g37560.1LOC_Os02g12730.3LOC_Os02g12730.2
LOC_Os02g12730.1LOC_Os03g06940.2LOC_Os03g06940.1LOC_Os01g39830.1LOC_Os03g15020.2
LOC_Os01g65460.2LOC_Os01g65460.1LOC_Os01g34920.1LOC_Os10g18400.1LOC_Os10g19960.1
LOC_Os06g42310.1
Panicum virgatumPavirv00010319mPavirv00012002mPavirv00013315mPavirv00037614mPavirv00065729m
Pavirv00038061mPavirv00063900mPavirv00063103mPavirv00033311m
Physcomitrella patensPp1s10_144V6.1Pp1s24_113V6.1Pp1s189_71V6.1Pp1s189_65V6.1
Phaseolus vulgarisPhvul.004G096800.1Phvul.003G050100.1Phvul.011G077600.1Phvul.011G074300.1Phvul.011G074900.1
Phvul.009G012700.1Phvul.005G160000.1Phvul.010G139300.1Phvul.002G167200.1Phvul.003G258300.1
Phvul.001G010900.1Phvul.009G232500.1Phvul.003G137000.1Phvul.009G153100.1Phvul.011G075900.1
Picea abiesMA_72251g0010MA_98513g0010MA_10427427g0010MA_10428400g0010
Populus trichocarpaPotri.009G012400.6Potri.009G012400.5Potri.009G012400.4Potri.009G012400.3Potri.009G012400.2
Potri.009G012400.1Potri.017G057900.1Potri.005G232600.1Potri.001G200400.3Potri.001G200400.1
Potri.006G144500.5Potri.006G144500.4Potri.006G144500.3Potri.006G144500.2Potri.006G144500.1
Potri.003G038500.4Potri.003G038500.3Potri.003G038500.2Potri.003G038500.1Potri.007G018100.7
Potri.007G018100.6Potri.007G018100.5Potri.007G018100.4Potri.007G018100.2Potri.007G018100.1
Potri.004G159800.1Potri.011G044300.2Potri.011G044300.1Potri.006G139100.3Potri.001G025700.1
Potri.001G025800.1Potri.T154000.1Potri.006G139100.1Potri.018G062800.1Potri.007G099800.1
Potri.001G200400.2Potri.004G159800.2Potri.006G139100.2Potri.007G099800.2
Prunus persicappa001149mppa002271mppa001412mppa001334mppa001382m
ppa001415mppa001340mppa001363mppa001345mppa020752m
ppa001480mppa001479m
Ricinus communis28076.m00042829904.m00289929739.m00372030170.m01410828694.m000675
29917.m00196129739.m00374030131.m00709429912.m00532330193.m000718
29912.m00532429815.m000493
Setaria italicaSi021080mSi034234mSi034250mSi034249mSi000317m
Si000291mSi016472m
Selaginella moellendorffii269483404798413650
Sorghum bicolorSb08g004410.1Sb01g040750.1Sb04g007660.1Sb10g022620.1Sb01g046160.1
Sb03g025990.1Sb03g041450.1Sb03g023500.1
Thellungiella halophilaThhalv10016234mThhalv10016215mThhalv10020056mThhalv10024679mThhalv10024387m
Thhalv10006871mThhalv10011265mThhalv10024511mThhalv10012695mThhalv10012847m
Thhalv10010152mThhalv10003705m
Vitis viniferaGSVIVT01020995001GSVIVT01025170001GSVIVT01016849001GSVIVT01018853001GSVIVT01009791001
GSVIVT01024221001GSVIVT01015203001GSVIVT01015038001GSVIVT01022339001GSVIVT01033736001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)