y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_24.25
FamilyGH35
Protein PropertiesLength: 584 Molecular Weight: 64272.6 Isoelectric Point: 8.6991
ChromosomeChromosome/Scaffold: 24 Start: 682005 End: 686401
Descriptionbeta-galactosidase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3521992.1e-32
  YKKWGDKDRHRSAEDIAFAVARFFQRGGTLQNYYMYHGGTNFGRTSGLSITTSYDYDAPIDEYGNPRQPKWGHLKQLHA
Full Sequence
Protein Sequence     Length: 584     Download
MVEGKRNEKE VDGTVMIVVK YKKWGDKDRH RSAEDIAFAV ARFFQRGGTL QNYYMYHGGT    60
NFGRTSGLSI TTSYDYDAPI DEYGNPRQPK WGHLKQLHAA IKLGEKIITN GAATTKDLGN    120
GVELTTFTNN ATGERFCYLS NLNTTNDANI DLKKDGNSYF VPAWSVSILN GCNKEVFNTA    180
KVNVQTSLMI KKPLVPSFFW TWAPEAMDNM LNGIGRFNAS QLLDQKQASS DASDYLWYIT    240
SAVVNKPELK NASLYVNSSG EILHAYVNKI SIGYEIGEKG FQFQKPVSLK HGRNVISLLS    300
VTVGLRNYGS FFEMEPNGIR GGPVKLEDSK NVTLLDLSSN TWNYKVGLDG EEKRMFDPSS    360
EKGIGNAWKT SGKLPINRPM TWYKTTFKVS KAIDPMVLDL QGMGKGQAWV NGNSLGRFWV    420
TQTANPRGCS ATCNYRGTYA VAKCESNCGN PSQRWYHVPR SFLNDQTNTL ILFEEFGGNP    480
SNVSLQTITI GTICGNAYEE SVLELSCQGG LKISGVQFAS FGDLQGSCGS FREGSSNVAN    540
TISIVQKECV GKEKCSIFVS EKIFGDGSKN IIPNRLAVQA VCS*                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin8.0e-1350558281+
pfam01301Glyco_hydro_356.0e-352110185+
PLN03059PLN030593.0e-14821583593+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27773.1021582271835unnamed protein product [Vitis vinifera]
RefSeqXP_002276918.1021582202766PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324727.1021547202744predicted protein [Populus trichocarpa]
RefSeqXP_002326135.1021583261824predicted protein [Populus trichocarpa]
RefSeqXP_002516236.1021583194761beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4e8d_B0.0000012186244315A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB4e8d_B0.0003275485426581A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB4e8d_A0.0000012186244315A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB4e8d_A0.0003275485426581A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB4e8c_B0.0000012186244315A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2837993361244570
FC8870493271244480
DY264749273212900
HO778160483214920
FC915116224212410
Orthologous Group
SpeciesID
Citrus clementinaCiclev10001020m
Cucumis sativusCucsa.129060.1.166.261Cucsa.129060.1.166.261
Eucalyptus grandisEucgr.A01928.1
Fragaria vescamrna06528.1-v1.0-hybrid
Mimulus guttatusmgv1a022675m
Panicum virgatumPavirv00051048m
Phaseolus vulgarisPhvul.009G225100.1.146.226Phvul.009G225100.1.146.226
Picea abiesMA_10436863g0010MA_87238g0010.299.379MA_87238g0010.299.379
Ricinus communis29739.m003719.176.27329739.m003719.176.273
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny