y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_28.7
FamilyGH35
Protein PropertiesLength: 248 Molecular Weight: 28033.3 Isoelectric Point: 7.216
ChromosomeChromosome/Scaffold: 28 Start: 49297 End: 50786
Descriptionbeta-galactosidase 15
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH351032320
  TIDGQGKILLSGSIHYPHSTSQMWPDLIKKAKEGGLDAIETYVFWNVHEPQRSQYDFNDNLDLLRFIKTIHQERLYSVVRIGPYVCAEWNYEGFPVWLHN
  MPRIELQTANNVYMNEMQNFTTLIVDMLKK
Full Sequence
Protein Sequence     Length: 248     Download
MREAVAQVLE PAKPVVQSRL LVGYYQMKTD GVAGDARRCS AAAAAAASTK SSHLMSFTHD    60
QNLAELEYAP LLLSYRLNQL WPPLVCVVCV NGIQVAHDGK VITIDGQGKI LLSGSIHYPH    120
STSQMWPDLI KKAKEGGLDA IETYVFWNVH EPQRSQYDFN DNLDLLRFIK TIHQERLYSV    180
VRIGPYVCAE WNYEGFPVWL HNMPRIELQT ANNVYMNEMQ NFTTLIVDML KKEKLLRTYC    240
FSPGINV*                                                             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA1.0e-1695201109+
PLN03059PLN030591.0e-5971238168+
pfam01301Glyco_hydro_354.0e-66102232131+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ09953.109523825169beta-galactosidase [Mangifera indica]
RefSeqNP_683341.108423831188BGAL15 (beta-galactosidase 15); beta-galactosidase [Arabidopsis thaliana]
Swiss-ProtQ9C6W40842388165BGL15_ARATH RecName: Full=Beta-galactosidase 15; Short=Lactase 15; Flags: Precursor
RefSeqXP_002516237.109023820168beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002516256.109023842190beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D9e-2310523121147A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C9e-2310523121147A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_B9e-2310523121147A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_A9e-2310523121147A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thc_D9e-2310523121147A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FR622350151882380
DY965978147902360
GR457807144952380
FR617786155842380
FD568609149902380
Orthologous Group
SpeciesID
Brassica rapaBra008306
Carica papayaevm.TU.contig_28540.1
Cucumis sativusCucsa.155220.1Cucsa.374340.1
Linum usitatissimumLus10025108.29.144Lus10005070.37.184Lus10005070.37.184Lus10025110.33.156Lus10025110.33.156
Lus10025108.29.144Lus10025108.29.144Lus10020877.21.135Lus10020877.21.135
Malus domesticaMDP0000206653MDP0000275455
Phaseolus vulgarisPhvul.009G225100.1.36.150Phvul.009G225100.1.36.150
Picea abiesMA_10430283g0010MA_19375g0010MA_329922g0010
Ricinus communis59437.m0000529739.m003719.32.14629739.m003719.32.146
Vitis viniferaGSVIVT01006709001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny