y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_33.19
FamilyGT77
Protein PropertiesLength: 832 Molecular Weight: 94922.7 Isoelectric Point: 8.5682
ChromosomeChromosome/Scaffold: 33 Start: 136989 End: 141355
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT774366560
  VTNYVICALDEETYQFSILQGLPVFRDPLSPSNISFNDCHFGTKCFQRVTKVKSRIVLKILKLGYNVLLSDVDVYWFRNPLSFLCSFGPAVLAAQSDEYN
  QTGPINLPRRLNSGFYFARSNSPTILSMEKVVKHAASSGLSEQPSFYDTLCGEGGSQRVGDNKCVEQETNLTVHFLDRNLFPNGAYLGLWQKNNVKAACV
  KKGCFVLHNNWISGRVKKLER
Full Sequence
Protein Sequence     Length: 832     Download
MGLFFLRKNL QAIQVVLWSV WLSGFLLIGL SLYATQIKDH INNPKFNHNM DTSKITIFTG    60
PSPFTGSVGA RQSLAIRSWL ALSSQVTVVL FSRHPSVVSF AEAYGSRVLV DPNIDFTFLG    120
TPFFHSMVAR SQEFMSDISV LINPETIVLP DLISTLGYTR QLNRDWLLFA LSQNLSDFPF    180
YLDESSQQWL NMDGEKMNIQ QEMLNETWQR SCCEGRMLMA WNSADLPLHN GVLPPFLFQK    240
GLHYQWIINE ALSCDKRFVF DASRTVSSFF LNVHDHQSSW SFRGPNASLF ERRSWEYVGN    300
SHLAALYGSL FFHENKFSSL VRLTKCGENY LFGNTTENVH HYIYQKFSSR KKRILNSWRF    360
KKHLACIDDA KTVNRISDCF IEDKLKPFTP LNFPLPLESL LPLVADKNRT IVLAVAGYSY    420
KDMLMSWACR LRQLAVTNYV ICALDEETYQ FSILQGLPVF RDPLSPSNIS FNDCHFGTKC    480
FQRVTKVKSR IVLKILKLGY NVLLSDVDVY WFRNPLSFLC SFGPAVLAAQ SDEYNQTGPI    540
NLPRRLNSGF YFARSNSPTI LSMEKVVKHA ASSGLSEQPS FYDTLCGEGG SQRVGDNKCV    600
EQETNLTVHF LDRNLFPNGA YLGLWQKNNV KAACVKKGCF VLHNNWISGR VKKLERQVSS    660
GLWDYDISTR MCLQRVVHPG GEEESYQTAI PASQMMDRYT GMCVARPEVF KNPHDSLLQP    720
EEKLLPGQKY LLIPLTTVQK LTRRHQETVE VNEATEDTSD ARITWDVSSE NLEESVYSAK    780
DFYVSREKSS RLLTRRNGRI KKPFVPPLPK VRACHTLGWE PNLTSIQEIS P*            840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14009DUF42281.0e-8675828168+
pfam03407Nucleotid_trans8.0e-52434657225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52325.101276731535AC011663_4 hypothetical protein; 72471-70598 [Arabidopsis thaliana]
EMBLCAN65937.101276741535hypothetical protein [Vitis vinifera]
EMBLCBI18645.103767420608unnamed protein product [Vitis vinifera]
RefSeqXP_002271910.101277721694PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.101276751552predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX1364523123156250
EL3424482514246740
EL3544682863886730
EH6740232533616130
GO9564462174586740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny