y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_332.7
FamilyGT59
Protein PropertiesLength: 508 Molecular Weight: 58211.2 Isoelectric Point: 10.0966
ChromosomeChromosome/Scaffold: 332 Start: 208091 End: 212036
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59244580
  TVPEPYMDEIFHVPQAQQYCQGNFSSWNPMITTPPGLYYLSLAYVATLFPGMFFLQAASSFSEACSPAMLRFTNSILVVLCSVLVFEIITHLRPVLSDKK
  ATFIAVITAMYPLHWFFTFLYYTDVASLTAVLAMYLACLKKKYKFSALLGALAVFIRQTNIIWMLFVLCTKVINISLGHQRDSMKDDESIEKTNQINPKN
  SVIMSSNLRKRKSNGNADIHKRARPRAISVSMAPKPGLFDEILAVILTSWRMKWELLLTFGPFFIVLMAFAGFVIWNGGIVLGAKEAHVVSPHFAQIMYF
  GLVSALAVAPLHFNIIQARDLFRSFWKNRPNSLLLCVIALIAGFLAVHFFSIAHPYLLADNRHYTFYLWRKVINADQSRKYLFVPLYVYSWFSILNLLGK
  TRRKVWVLVFFLANVAVLVPAPLIEFRYYTIPFFL
Full Sequence
Protein Sequence     Length: 508     Download
MGKLAVAAVV ILWVVPISIL VNRTVPEPYM DEIFHVPQAQ QYCQGNFSSW NPMITTPPGL    60
YYLSLAYVAT LFPGMFFLQA ASSFSEACSP AMLRFTNSIL VVLCSVLVFE IITHLRPVLS    120
DKKATFIAVI TAMYPLHWFF TFLYYTDVAS LTAVLAMYLA CLKKKYKFSA LLGALAVFIR    180
QTNIIWMLFV LCTKVINISL GHQRDSMKDD ESIEKTNQIN PKNSVIMSSN LRKRKSNGNA    240
DIHKRARPRA ISVSMAPKPG LFDEILAVIL TSWRMKWELL LTFGPFFIVL MAFAGFVIWN    300
GGIVLGAKEA HVVSPHFAQI MYFGLVSALA VAPLHFNIIQ ARDLFRSFWK NRPNSLLLCV    360
IALIAGFLAV HFFSIAHPYL LADNRHYTFY LWRKVINADQ SRKYLFVPLY VYSWFSILNL    420
LGKTRRKVWV LVFFLANVAV LVPAPLIEFR YYTIPFFLSV LHYDINSYRS WLLIGILYIV    480
VNAFTMMMFL YRPFHWSHEL GVQRFIW*                                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG101.0e-10022458440+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1015071498putative protein [Arabidopsis thaliana]
EMBLCAN64153.102750727517hypothetical protein [Vitis vinifera]
RefSeqNP_195861.2015071509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.102750727510PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509451.102737327376conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
421
5981
91113
126148
168190
280302
317339
359381
404421
428447
472494
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2672952852205040
DN49573823812350
HS40986924812450
JG638331273122800
DY27512517111710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny