y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_37.144
FamilyGH35
Protein PropertiesLength: 834 Molecular Weight: 93692.1 Isoelectric Point: 8.7308
ChromosomeChromosome/Scaffold: 37 Start: 1157073 End: 1161680
Descriptionglycosyl hydrolase family 35 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35413450
  LIVNGKRELLYSGSIHYPRSTPDMWPSILAKARRGGLNVIQTYVFWNIHEPVQGQYNFTGNYDLVKFIKLVQEHGMFVTLRLGPFIQAEWNHGGLPFWLR
  EVPGIIFRSDNEPWKHHMEKYVKMVLDKCKAEKLFAPQGGPIILAQIENEYSAIQRAYRALGDSYVQWAAKMAQSMNIGVPWAMCKQNDAPDPMINACNG
  RHCGDTFPGPNSPNKPAIWTENWTAQFRVFGDPPSQRSAEDIAFSVARFFSKNGTLVNYYMYHGGTNFGRTGAHFVTTRYYDEAPLDEYGLLREPKYGHL
  KHLHR
Full Sequence
Protein Sequence     Length: 834     Download
MITFPCLRSV LLAAILSSFL VSCAVAHGKK EQAVTYDGRS LIVNGKRELL YSGSIHYPRS    60
TPDMWPSILA KARRGGLNVI QTYVFWNIHE PVQGQYNFTG NYDLVKFIKL VQEHGMFVTL    120
RLGPFIQAEW NHGGLPFWLR EVPGIIFRSD NEPWKHHMEK YVKMVLDKCK AEKLFAPQGG    180
PIILAQIENE YSAIQRAYRA LGDSYVQWAA KMAQSMNIGV PWAMCKQNDA PDPMINACNG    240
RHCGDTFPGP NSPNKPAIWT ENWTAQFRVF GDPPSQRSAE DIAFSVARFF SKNGTLVNYY    300
MYHGGTNFGR TGAHFVTTRY YDEAPLDEYG LLREPKYGHL KHLHRALNLC KKALLWGEPR    360
VERLEKDVEV RYYQQPGTKV CAAFLANNDT KQAKTVKFKG QEFLLPSRSI SILPDCKTVV    420
FNTATIVAQH NSRSYHESEK ANKNLNFEMY SENIPTRLSD VNVIPHELFG LTKDVSDYAW    480
YTTTIKLDPE DLPMKKDILP VLRVSSLGHA LAAFVNGEYV GNAHGSHEEK SFVFQKPIKL    540
HVGVNDITIL GMLTGFPDSG AYLEHRYAGP RGISILGLNT GTLDLTENFW GHRVGLEGEK    600
ASWFTEEGSQ KLNWKKAGGN APAFTWYKTY FDAPESDNPV VVRMDTMGKG MIWVNGNNIG    660
RFWTAFKSPL GQPSQSEYHV PRAYLKPKDN LLVILDEEPG VEPNKIQFLL VKRDTICSHI    720
SETYPPNVKS WTREKNKIRP VVDEVKLMAS LKCPSHKQIV AVEFTSFGNP FGSCGSFYNG    780
NCTAPGTKEI VEKYCLGKES CSIPFDRSIF LKNNDGCADS PKSLAIQVKC GGK*          840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_429.0e-556191151+
pfam02140Gal_Lectin2.0e-1775183083+
COG1874LacA1.0e-1834191166+
pfam01301Glyco_hydro_351.0e-15640347322+
PLN03059PLN0305909830849+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD24606.103783131827putative beta-galactosidase [Arabidopsis thaliana]
RefSeqNP_179264.203483144843BGAL13; beta-galactosidase [Arabidopsis thaliana]
RefSeqNP_567973.103283139840BGAL11 (beta-galactosidase 11); beta-galactosidase [Arabidopsis thaliana]
RefSeqXP_002306183.102483321829predicted protein [Populus trichocarpa]
RefSeqXP_002312963.10108337828predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A8.00001e-414034314325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.0002620696506572A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D8e-403434311330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C8e-403434311330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77816074897300
CO128575295633570
HO780602590846660
CO121155290893780
CO112063271893590
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)