y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_62.116
FamilyGT77
Protein PropertiesLength: 435 Molecular Weight: 49510.1 Isoelectric Point: 9.6885
ChromosomeChromosome/Scaffold: 62 Start: 735962 End: 737551
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771884090
  IPNYLVVALDSEITSFCQSKSVPVYETDLDKDIDTVARTGGAHDVSRLKFQILTEFLQLGYCILVSDVAVVYLQNPFDHLYRDSDVEALSDGHSNRTAYG
  FDDVFDDPAMGWARYAHSMRIWVYNSGFFYIRPTIPAIELLVHVADRVSREKTWDQEIFNEELFFPSNPYYHGLHASRRSMDFYLFMNSKVLFKFVRKDA
  NLIRRIKPVIVYVNYHPDQLPR
Full Sequence
Protein Sequence     Length: 435     Download
MNCRREKIRS SSLSRPSRIS IAIAIGISFG CFFAFIFPRG ILSPLSLNSP RLHYRRSAVS    60
NLIVPTKCET SVRPSALKVK AQLVMASERN AVLKRQVKEL SAKLTLAEQL KDIAQKQILS    120
REQHKAGPFG SAKSLRINPT SPDESVNPRL AKTLRKIAVQ GELIVALANS NMKEMLEVWF    180
TSIKRVDIPN YLVVALDSEI TSFCQSKSVP VYETDLDKDI DTVARTGGAH DVSRLKFQIL    240
TEFLQLGYCI LVSDVAVVYL QNPFDHLYRD SDVEALSDGH SNRTAYGFDD VFDDPAMGWA    300
RYAHSMRIWV YNSGFFYIRP TIPAIELLVH VADRVSREKT WDQEIFNEEL FFPSNPYYHG    360
LHASRRSMDF YLFMNSKVLF KFVRKDANLI RRIKPVIVYV NYHPDQLPRM KAIVEFYVNG    420
KQDALKPFPD GSDW*                                                     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-41188405224+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK94035.104543347435unknown [Populus trichocarpa]
DDBJBAC83249.101343322426hypothetical protein [Oryza sativa Japonica Group]
GenBankEEC82354.101343322426hypothetical protein OsI_26669 [Oryza sativa Indica Group]
RefSeqNP_001140234.101343319423hypothetical protein LOC100272274 [Zea mays]
RefSeqXP_002465078.101343320425hypothetical protein SORBIDRAFT_01g031700 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2681363091294350
GO8485352991364330
FF3935532731504220
GO3666783031354350
GO7961232691434110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00429.1
Arabidopsis lyrata476651472163476650
Arabidopsis thalianaAT1G19360.1AT1G75120.1AT1G75110.1
Brachypodium distachyonBradi1g15990.1Bradi1g23050.1
Brassica rapaBra016507Bra025734
Carica papayaevm.model.supercontig_64.63
Capsella rubellaCarubv10021612mCarubv10011112mCarubv10020421mCarubv10021694m
Chlamydomonas reinhardtiiCre12.g552400.t1.3Cre10.g418300.t1.2g11937.t1Cre06.g288500.t1.2Cre02.g111000.t1.2
Citrus clementinaCiclev10001254m
Citrus sinensisorange1.1g014357m
Cucumis sativusCucsa.342160.1Cucsa.240290.1
Eucalyptus grandisEucgr.I01250.1Eucgr.I01251.1Eucgr.I01249.1Eucgr.F01547.1
Fragaria vescamrna02178.1-v1.0-hybridmrna15113.1-v1.0-hybrid
Glycine maxGlyma11g12750.1Glyma14g08280.1Glyma12g04930.1Glyma17g36770.2
Gossypium raimondiiGorai.012G146400.1Gorai.012G146400.2Gorai.010G011500.1
Linum usitatissimumLus10026327Lus10032710Lus10042340Lus10018812
Malus domesticaMDP0000152163MDP0000259542MDP0000518381MDP0000208242MDP0000314698
MDP0000242848
Manihot esculentacassava4.1_007950mcassava4.1_008109m
Mimulus guttatusmgv1a006896mmgv1a006728mmgv1a006960m
Oryza sativaLOC_Os07g39840.1
Panicum virgatumPavirv00016039mPavirv00037224mPavirv00044239mPavirv00031762m
Physcomitrella patensPp1s246_43V6.1Pp1s351_31V6.1
Phaseolus vulgarisPhvul.001G015800.1Phvul.011G047000.1
Picea abiesMA_54369g0010
Populus trichocarpaPotri.014G042700.1Potri.014G042700.2Potri.014G042700.3Potri.002G134400.1Potri.009G113300.1
Prunus persicappa006072mppa005997m
Ricinus communis30170.m01400629851.m002438
Setaria italicaSi029932mSi035830m
Selaginella moellendorffii103279431230
Sorghum bicolorSb02g037900.1Sb01g031700.1
Thellungiella halophilaThhalv10007712mThhalv10018600m
Vitis viniferaGSVIVT01009666001GSVIVT01031309001
Volvox carteriVocar20009953mVocar20009597mVocar20012076m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny