y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_64.120
FamilyGH35
Protein PropertiesLength: 856 Molecular Weight: 96407.1 Isoelectric Point: 9.4707
ChromosomeChromosome/Scaffold: 64 Start: 825260 End: 832377
Descriptionbeta-galactosidase 16
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35703740
  LVIDGQHKILFSGSIHYPRSTPQMWPSLIAKAREGGLDVIETLVFWNLHEPKPGQFDFSGRRDLVRFIKEIQAQGLYACVRIGPFIQGEWGYGGLPIWLH
  DVPGIVFRSDNEPFKNHMQQYAKIIVNLLKSERLFASQGGPIILSQIENEYGMVQKAFGEKGKAYLQWTAKLAVELDTGVPWVMCKQDDAPDPVINACNG
  RRCGETFAGPNSPNKPAIWTENWTTSYEVYGKEPRLRSAEDIAFHVVLFIAKKGSYVNYYMYHGGTNFGRTGSEYVLTSYYDKAPLDEYGLLRQPKWGHL
  KELHA
Full Sequence
Protein Sequence     Length: 856     Download
MPFRVRFTDI SILFPQFCSS ARSNTERIRE GVKKKKKKMV RSLLFLSVLI AASMMEKCGG    60
VNVSYDGRSL VIDGQHKILF SGSIHYPRST PQMWPSLIAK AREGGLDVIE TLVFWNLHEP    120
KPGQFDFSGR RDLVRFIKEI QAQGLYACVR IGPFIQGEWG YGGLPIWLHD VPGIVFRSDN    180
EPFKNHMQQY AKIIVNLLKS ERLFASQGGP IILSQIENEY GMVQKAFGEK GKAYLQWTAK    240
LAVELDTGVP WVMCKQDDAP DPVINACNGR RCGETFAGPN SPNKPAIWTE NWTTSYEVYG    300
KEPRLRSAED IAFHVVLFIA KKGSYVNYYM YHGGTNFGRT GSEYVLTSYY DKAPLDEYGL    360
LRQPKWGHLK ELHAAIKLCS RPLLSGVQMK MSLGDQQEAF VFRENSQVCA AFLVNNDIRR    420
NVTVQFQNIS YELPPKSISI LPDCKIVAFN TAKVTTQYTT RSMQPSKRFD SIEIWEEYKE    480
SIPTFDETSL RANTILEQMN TTKDTSDYLW YTFRYEHQSS KTKSVLRVEH LGHVLHAFVN    540
GQFAGSGHGS FDQKRFIMEN TISLNNGTNY VSLLSVTVGL PDSGPHLERR AAGLRSLRIQ    600
RTKGYLDDFQ DYPWGYQVGL VGEKLKIYTE NGARKIQWSK HNNSTHQPLT WYKTFFYAPP    660
GRDPVALDLG SMGKGEAWIN GESIGRYWVS ILTRGSPSQT WYNIPRSFLK TTGNLLVIFE    720
EEKGNPAEIS VDTVSITKVC GQVSKSHPPP VISWRGQQQD EPVEKTRHHG RRPKVNLRCP    780
PGRNISKILF ASFGTPSGDC QNYSVGACHS SHSLPVAKRA CVGKNKCSIP LRNDRFGGDP    840
CPGISKSLLV DALCT*                                                    900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_422.0e-685221151+
pfam02140Gal_Lectin3.0e-2177785481+
COG1874LacA2.0e-2163221169+
pfam01301Glyco_hydro_353.0e-15069376322+
PLN03059PLN03059043855844+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18990.104885514817unnamed protein product [Vitis vinifera]
EMBLCBI18991.106485433820unnamed protein product [Vitis vinifera]
RefSeqNP_177866.204385511815BGAL16 (beta-galactosidase 16); beta-galactosidase/ catalytic/ cation binding / sugar binding [Arabidopsis thaliana]
RefSeqXP_002284529.106485425812PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302225.10598554798predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A1e-346937214325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.0004633728493580A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D1e-306336311322A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C1e-306336311322A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160724437360
HO7806025941136960
HO7955525291536710
HO79555275401140
HO780602276957210.21
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)