y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDg13798.t1
FamilyGT90
Protein PropertiesLength: 565 Molecular Weight: 60252.3 Isoelectric Point: 9.431
ChromosomeChromosome/Scaffold: 12 Start: 9550878 End: 9555188
DescriptionArabidopsis thaliana protein of unknown function (DUF821)
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT902154521e-35
  GVWPEPPARQHGRLPVMRHCKAATSTDIAVPIFHMYTLRLDEALLAAGAQERLARDHPWEARQQAAFAAGTNYHRHQVVPSTLKQWDGKNRGKTVEMVRE
  ALADYLAQELQHPNITYSKGSTPIADWARYRMVMHVDGISCSSRIVQLLALGSVVLREQSGYMGFYDRLLTKFVHYVPFWSQRPREVLWAYNWVLANDEA
  ARAIAARGQAFARHFLSREAVECFWLLLLRHYARLQRF
Full Sequence
Protein Sequence     Length: 565     Download
MPARCQSGSP PADVNHVDLR ARPRRPPRRA LLAVSLISVV TWWGCLWPLA AGRGSNSSSA    60
GGRSSSAGGK DSLVASHCAR YSAFEAGIAE DLLPWYDQGI SEALADRLLQ ERSMGGRHRA    120
PGLPLAVVGG RLYVVGLAGD GPGAADQQRI ANCWPWQAEN LVTYAHAMRR LVARWGGALP    180
DLEFLVETQD APGQDMGVGG QGQPGAQPDP AAEWGVWPEP PARQHGRLPV MRHCKAATST    240
DIAVPIFHMY TLRLDEALLA AGAQERLARD HPWEARQQAA FAAGTNYHRH QVVPSTLKQW    300
DGKNRGKTVE MVREALADYL AQELQHPNIT YSKGSTPIAD WARYRMVMHV DGISCSSRIV    360
QLLALGSVVL REQSGYMGFY DRLLTKFVHY VPFWSQRPRE VLWAYNWVLA NDEAARAIAA    420
RGQAFARHFL SREAVECFWL LLLRHYARLQ RFRPGTRAVA AAAAAARNSI GTGGAQQLVL    480
TPIDDWLAKQ EGTVSGWAPT HVADRGGELD LLPAVDMTAA AAVAGGQGGG AGAAAATAAG    540
AAGAPGAVAG TGRIGGKGAA GRAS*                                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart00672CAP101.0e-7221452249+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001690317.10.00264129417483predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001690317.12.99878e-43244428503703predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001694568.12e-1711845438094114predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001703030.10483258285predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_002195971.10.000000000000001215457324561PREDICTED: similar to KDEL (Lys-Asp-Glu-Leu) containing 1 [Taeniopygia guttata]
Transmembrane Domains
StartEnd
3052
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BE45297611411142.8026e-45
BE452976281161432.8026e-45
FC1042751143424553e-18
FD8292171433424780.00000000000007
AV626787491490.0000000007
Orthologous Group
SpeciesID
Chlamydomonas reinhardtiig17998.t1Cre16.g692150.t1.3Cre07.g329350.t1.2Cre09.g413850.t1.2g11600.t2
Cre13.g603100.t2.1Cre13.g603100.t1.3g11600.t1g8766.t1Cre08.g361150.t1.2
Cre09.g413900.t1.2Cre07.g344500.t1.2Cre13.g580950.t1.3Cre16.g692150.t2.1Cre13.g581000.t2.1
Cre13.g581000.t1.3g14272.t1g14272.t2Cre09.g413250.t1.2Cre17.g716350.t1.2
g4406.t1g4400.t1Cre12.g522750.t1.3g18267.t1Cre16.g687750.t1.2
Cre03.g203550.t3.1Cre16.g694800.t1.3g4898.t2g4898.t1Cre16.g694750.t1.2
g9592.t1Cre03.g203550.t1.3Cre01.g007550.t1.3Cre03.g203550.t4.1Cre03.g203550.t2.1
g4406.t2Cre09.g415300.t1.3Cre09.g414150.t3.1Cre09.g414150.t2.1Cre09.g414150.t1.3
g11596.t1g4406.t3Cre04.g221150.t1.3Cre04.g220900.t1.2Cre06.g270400.t1.2
Volvox carteriVocar20006763mVocar20007153mVocar20005735mVocar20005991mVocar20013900m
Vocar20002298mVocar20011795mVocar20000471mVocar20007739m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny