y PlantCAZyme

CAZyme Information

Basic Information
SpeciesChlamydomonas reinhardtii
Cazyme IDg3003.t1
FamilyAA5
Protein PropertiesLength: 655 Molecular Weight: 68935.3 Isoelectric Point: 8.1869
ChromosomeChromosome/Scaffold: 3 Start: 916232 End: 921427
Descriptionglyoxal oxidase-related protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA5226500
  AVLLFTQSALADKSVTRNAVATDAAVANDEQPHHDTFSSGHTDPLVAQEVAQEATPPPPRYRRPPPSPFSKTTRPPRPITIANSPSTPPPPPNPPPPPPP
  VITPPATAGSFVKLDTLAPVVALAMSNVPFTRKYLLFERAYGPSEVAMGFVVRPTGGTVDLDTNKTTNFSPAYNPGCSGVGHLPDNKIYTYGGDVPSAPR
  GMGDGRNKIMVFDPAANKLVVVGTMQKNRWYPSPLTLINGKVLIVGGTDIGLVPPTWDFAELWDPAAPASPTVKVTMPANLVKYMGLNWYPFMQLLSNGD
  ILWFVEKGGAITDGNFNHIVDLPPFPASITHCTMFPKTSSISVLAMGPPTYDLSFVIFGGGDCSNSATIKSVNIPPAASTSLRLDITKCGSSYCFTKGWE
  VEDMLGVPRVMGDSTLLPNGKVLLHGGAQFGGANSGEGWSTKANFQSLVYDPYKPAGQRYSKMDFAPIARVYHSANCLDPSGKVLVAGCENCGAYQQLAT
  GMSLSPNAPLEMRLEFAVPVEIGTGVVRPIIIAAPEAITKGTTFKVSYSYPGGGAITRVALVAPCAATHSINMGQRVIYLQVLSATPAGTLTVAAPPSAL
  MGKALLGPFLLFLVADGAALGPVYSEGVW
Full Sequence
Protein Sequence     Length: 655     Download
MKQPRRGGEP GTAAAFCCAV LAVLLFTQSA LADKSVTRNA VATDAAVAND EQPHHDTFSS    60
GHTDPLVAQE VAQEATPPPP RYRRPPPSPF SKTTRPPRPI TIANSPSTPP PPPNPPPPPP    120
PVITPPATAG SFVKLDTLAP VVALAMSNVP FTRKYLLFER AYGPSEVAMG FVVRPTGGTV    180
DLDTNKTTNF SPAYNPGCSG VGHLPDNKIY TYGGDVPSAP RGMGDGRNKI MVFDPAANKL    240
VVVGTMQKNR WYPSPLTLIN GKVLIVGGTD IGLVPPTWDF AELWDPAAPA SPTVKVTMPA    300
NLVKYMGLNW YPFMQLLSNG DILWFVEKGG AITDGNFNHI VDLPPFPASI THCTMFPKTS    360
SISVLAMGPP TYDLSFVIFG GGDCSNSATI KSVNIPPAAS TSLRLDITKC GSSYCFTKGW    420
EVEDMLGVPR VMGDSTLLPN GKVLLHGGAQ FGGANSGEGW STKANFQSLV YDPYKPAGQR    480
YSKMDFAPIA RVYHSANCLD PSGKVLVAGC ENCGAYQQLA TGMSLSPNAP LEMRLEFAVP    540
VEIGTGVVRP IIIAAPEAIT KGTTFKVSYS YPGGGAITRV ALVAPCAATH SINMGQRVIY    600
LQVLSATPAG TLTVAAPPSA LMGKALLGPF LLFLVADGAA LGPVYSEGVW LTLN*         660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07250Glyoxal_oxid_N4.0e-7154347220+
pfam09118DUF19297.0e-17549650102+
cd02851E_set_GO_C3.0e-25544653110+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001693542.10119654123664glyoxal or galactose oxidase [Chlamydomonas reinhardtii]
RefSeqXP_001695587.101466541530glyoxal or galactose oxidase [Chlamydomonas reinhardtii]
RefSeqXP_001695699.1013965383584glyoxal or galactose oxidase [Chlamydomonas reinhardtii]
RefSeqXP_001695700.101466531495glyoxal or galactose oxidase [Chlamydomonas reinhardtii]
RefSeqXP_001701523.10139653231727glyoxal or galactose oxidase [Chlamydomonas reinhardtii]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vz3_A0.0005430635439623A Chain A, Crystal Structure Of Beta-Glucosidase From Kluyveromyces Marxianus In Complex With Glucose
PDB2vz1_A0.0005430635439623A Chain A, Crystal Structure Of Beta-Glucosidase From Kluyveromyces Marxianus In Complex With Glucose
PDB2jkx_A0.0005430635439623A Chain A, Crystal Structure Of Beta-Glucosidase From Kluyveromyces Marxianus In Complex With Glucose
PDB2eie_A0.0005430635439623A Chain A, Crystal Structure Of Galactose Oxidase Complexed With Azide
PDB1goh_A0.0005430635439623A Chain A, Crystal Structure Of Galactose Oxidase Complexed With Azide
Transmembrane Domains
StartEnd
1332
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU6551271861783576e-36
BU6529502173975992e-35
BU6515661951973812e-34
FD8348552524246534e-31
BU6496761724896546e-29
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00849.1Aquca_002_00488.1Aquca_011_00031.1Aquca_006_00149.1Aquca_001_00162.1
Aquca_001_00162.2Aquca_011_00437.1Aquca_003_00264.1Aquca_020_00284.2Aquca_020_00284.1
Arabidopsis lyrata485786907231895435472215888820
475824488852
Arabidopsis thalianaAT3G53950.1AT3G57620.1AT1G75620.1AT1G14430.1AT1G19900.1
AT5G19580.1AT1G67290.1
Brachypodium distachyonBradi1g67590.1Bradi2g46477.1Bradi4g24270.1Bradi2g16900.1
Brassica rapaBra021337Bra003160Bra026220Bra026831Bra012193
Bra016489Bra025780Bra012194Bra015830Bra008211
Bra020050Bra034008Bra004215Bra002247
Carica papayaevm.model.supercontig_56.57evm.model.supercontig_140.32evm.model.supercontig_140.31evm.model.supercontig_34.155evm.model.supercontig_4.17
evm.model.supercontig_23.56
Capsella rubellaCarubv10016978mCarubv10019204mCarubv10012343mCarubv10021300mCarubv10011386m
Carubv10022352mCarubv10000533m
Chlamydomonas reinhardtiiCre17.g732350.t2.1Cre17.g732350.t1.3Cre06.g306000.t1.3g6393.t1g11468.t1
Cre16.g657200.t1.1g11469.t1Cre16.g657250.t1.2Cre05.g243450.t2.1Cre05.g243450.t1.3
g11470.t2g11470.t1Cre03.g152050.t1.2Cre16.g693950.t1.3g3001.t1
Cre16.g677300.t1.3g3002.t1Cre13.g577300.t1.2Cre17.g732600.t1.2Cre09.g396451.t1.3
g14185.t1
Citrus clementinaCiclev10011448mCiclev10031195mCiclev10000768mCiclev10024435mCiclev10003275m
Ciclev10010756mCiclev10010177mCiclev10006853mCiclev10033514mCiclev10007862m
Citrus sinensisorange1.1g044265morange1.1g041651morange1.1g048017morange1.1g009420morange1.1g043369m
orange1.1g035640morange1.1g039705morange1.1g042303morange1.1g048136morange1.1g042680m
Cucumis sativusCucsa.175840.1Cucsa.342810.1Cucsa.196370.1Cucsa.159730.1Cucsa.342800.1
Cucsa.116480.1
Eucalyptus grandisEucgr.B02726.1Eucgr.F01844.1Eucgr.B01735.1Eucgr.G02553.1Eucgr.B00180.1
Eucgr.C03801.1
Fragaria vescamrna11865.1-v1.0-hybrid
Glycine maxGlyma01g25830.1Glyma03g17300.1Glyma02g02610.1Glyma19g43050.1Glyma03g40410.1
Glyma04g02880.1Glyma14g40600.1Glyma06g02900.1Glyma06g02890.1Glyma06g18490.1
Glyma01g34760.1Glyma08g04030.1Glyma09g32620.2
Gossypium raimondiiGorai.006G169500.1Gorai.009G270800.1Gorai.007G286100.1Gorai.008G183000.1Gorai.006G263100.1
Gorai.006G263000.1Gorai.009G196400.1Gorai.006G262900.1Gorai.005G111300.1Gorai.006G205600.1
Gorai.002G125000.1Gorai.008G202800.1Gorai.002G255700.1Gorai.004G281100.1Gorai.004G281000.1
Gorai.004G281300.1Gorai.004G281200.1Gorai.006G262800.1
Linum usitatissimumLus10024342Lus10015949Lus10030798Lus10012979Lus10011110
Lus10024312Lus10011111Lus10043231Lus10011109Lus10043230
Lus10034959Lus10012981
Malus domesticaMDP0000263222MDP0000933146MDP0000646516MDP0000307326MDP0000896660
MDP0000267976MDP0000260251MDP0000241709MDP0000308649MDP0000449901
Manihot esculentacassava4.1_005270mcassava4.1_026071mcassava4.1_004735mcassava4.1_025197mcassava4.1_028841m
cassava4.1_004927mcassava4.1_023659mcassava4.1_027132m
Medicago truncatulaMedtr5g038410.1Medtr7g114530.1Medtr1g023570.1Medtr8g102900.1Medtr6g088300.1
Mimulus guttatusmgv1a004290mmgv1a021812mmgv1a024085mmgv1a004035mmgv1a003984m
mgv1a002908mmgv1a027114m
Oryza sativaLOC_Os03g15320.1LOC_Os01g48540.1LOC_Os11g06870.1LOC_Os05g48520.1
Panicum virgatumPavirv00053055mPavirv00012056mPavirv00004365mPavirv00023087mPavirv00049090m
Pavirv00010844mPavirv00050515mPavirv00034533mPavirv00031618m
Physcomitrella patensPp1s91_94V6.1Pp1s27_70V6.1Pp1s376_5V6.1Pp1s144_105V6.1Pp1s58_157V6.2
Pp1s58_157V6.1Pp1s408_24V6.1Pp1s183_100V6.1Pp1s1_343V6.2Pp1s78_90V6.1
Pp1s30_238V6.1Pp1s21_324V6.1Pp1s43_101V6.1Pp1s119_38V6.1Pp1s149_297V6.1
Pp1s172_1V6.1Pp1s53_16V6.1Pp1s217_43V6.1Pp1s36_150V6.1Pp1s1_232V6.1
Pp1s36_144V6.1Pp1s173_129V6.1Pp1s52_249V6.1Pp1s838_1V6.1Pp1s201_96V6.1
Pp1s56_214V6.1Pp1s1_343V6.1Pp1s70_122V6.1Pp1s143_112V6.1Pp1s12_143V6.1
Pp1s333_30V6.1Pp1s97_6V6.1Pp1s227_29V6.1Pp1s95_56V6.1Pp1s466_4V6.1
Phaseolus vulgarisPhvul.010G012100.1Phvul.002G066900.1Phvul.006G098100.1Phvul.009G014800.1Phvul.001G009200.1
Phvul.009G171700.1Phvul.009G014900.1Phvul.002G311300.1Phvul.004G168600.1
Picea abiesMA_187092g0010MA_412851g0010MA_460865g0010MA_56166g0010MA_138024g0010
MA_126260g0010MA_10436303g0010MA_10429735g0020MA_812690g0010MA_10437233g0040
MA_10429735g0010MA_65180g0010MA_22751g0010MA_10437233g0030MA_8764g0010
MA_10437233g0020MA_162584g0010MA_10433917g0010MA_658171g0010MA_437873g0010
MA_190917g0010
Populus trichocarpaPotri.016G103400.1Potri.005G047700.1Potri.T122300.1Potri.010G034200.1Potri.005G235500.1
Potri.002G027000.1Potri.005G235600.1Potri.013G034900.1Potri.001G083600.1Potri.006G160800.1
Potri.018G084200.1Potri.005G235500.2
Prunus persicappa003992mppa020922mppa003824mppa026498mppa004709m
ppa023406mppa004880mppa024999mppa023837m
Ricinus communis30170.m01414129736.m00204130128.m00864830068.m00258029912.m005477
Setaria italicaSi039186mSi028244mSi004698mSi024932mSi039059m
Si009806m
Selaginella moellendorffii2311198985244165141395977682
Sorghum bicolorSb01g040550.1Sb03g031030.1Sb06g021520.1Sb05g004490.1Sb09g028310.1
Sb08g004430.1
Thellungiella halophilaThhalv10023396mThhalv10018361mThhalv10007284mThhalv10007241mThhalv10013037m
Thhalv10018300mThhalv10012975m
Vitis viniferaGSVIVT01019657001GSVIVT01015345001.99.625GSVIVT01009837001GSVIVT01021883001
Volvox carteriVocar20012997mVocar20008016mVocar20003050mVocar20012921mVocar20012673m
Vocar20007701mVocar20010749mVocar20006807mVocar20007569m.41.551Vocar20007569m.41.551
Vocar20010653mVocar20010521mVocar20010943m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)