y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna00258.1-v1.0-hybrid
FamilyGH77
Protein PropertiesLength: 1203 Molecular Weight: 135989 Isoelectric Point: 6.8032
ChromosomeChromosome/Scaffold: 1 Start: 10862624 End: 10876720
Descriptiondisproportionating enzyme 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH775436769.6e-29
  IPMFSVRSETDLGVGEFLDLKLLADWAVESGFHLVQLLPINDTSVYGMWWDSYPYSSLSVSALHPLYLRVQALSENIPMDIKVEIQKAKEELDGKDVDYE
  ATLITKLSIGKKIFAQEKDKILTSNSFQNFFSEN
GH7766911260
  FQNFFSENQLSEAAEYARKKGVILKGDLPIGVGRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMAKDNYAWWRARLTQMAKYFTAYRI
  DHILGFFRIWELPEHAMTGLVGKFRPSIPLSQEELERDGIWDFDRLARPYIPQELLQIKFGDSWTFIASSFLNEYQKNRYEFKEDCNTEKKIASKLKSFS
  GRSLLQNEDHIRQELFDILQNIVLIRDPENPRNFYPRFNLEETSSFKDLDDHCKNVLKRLYYDYYFHRQEILWRENALKTLPALLNSSDMLACGEDLGLI
  PSCVYPVMQELGLIGLRIQRMPSEPGLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRYFSSMVGSDLLPPSRCVPEIANFIIRQHFEAPSMWA
  IFPLQDLLILKEEYTTRPAKEETINDPTNPKHYWRYRVHVTLEALIKDKELTSIIKDL
Full Sequence
Protein Sequence     Length: 1203     Download
MASGLTGVWW LWADGLWLTH RGGLGSERNQ DYIGWERRQV GIGDRDGRLD RCEGRFRSMI    60
IGSNSSCIIS VFWSVAEGLR YSTPSVDGWI ARRWRLDVGG RETWQSIFEL GPEGGLDCYL    120
LLSIRRCGRR PGIGTLCALS VLAPSPPYTY LRPSMPITKP IGSGSKDSKI GIVMNQIDID    180
DCDEGGGGGA DERCGKLHRR DRVVVVDEEG VLKILYRLRR VDPFGVKLHD LVDVERGRAH    240
HQGRGGVRGG GGGGGRERTS LKPIVVGLGK WGQSLVVCGS EPVLGSWNVK RGLQLSPVHQ    300
GDELIWFGTL SIPKGFGPCE YSYYVVDDDR NVVRWEMGKK RRLLLPQTFE GGEQLHLHDF    360
WQVGADALPF KSAFKDVVFR RECTLEIEKP LGLIQNSLQN DGISTPIQLP LGFKCPVISD    420
SSFFTDSLLV HFKVCCPNLQ EGTPIYIIGS CSKLGNWKAQ DGLKLFYAEI FNLLKLPSLS    480
LPLFLNGCST YKYCKCSKGG NISSETGPNR EIALDSSITE PRYLFRSDGM LQELPWRGAG    540
VAIPMFSVRS ETDLGVGEFL DLKLLADWAV ESGFHLVQLL PINDTSVYGM WWDSYPYSSL    600
SVSALHPLYL RVQALSENIP MDIKVEIQKA KEELDGKDVD YEATLITKLS IGKKIFAQEK    660
DKILTSNSFQ NFFSENQLSE AAEYARKKGV ILKGDLPIGV GRNSVDTWVY PNLFRMNTST    720
GAPPDYFDKN GQNWGFPTYN WEEMAKDNYA WWRARLTQMA KYFTAYRIDH ILGFFRIWEL    780
PEHAMTGLVG KFRPSIPLSQ EELERDGIWD FDRLARPYIP QELLQIKFGD SWTFIASSFL    840
NEYQKNRYEF KEDCNTEKKI ASKLKSFSGR SLLQNEDHIR QELFDILQNI VLIRDPENPR    900
NFYPRFNLEE TSSFKDLDDH CKNVLKRLYY DYYFHRQEIL WRENALKTLP ALLNSSDMLA    960
CGEDLGLIPS CVYPVMQELG LIGLRIQRMP SEPGLEFGIP SQYSYMTVCA PSCHDCSTLR    1020
AWWEEDEERR QRYFSSMVGS DLLPPSRCVP EIANFIIRQH FEAPSMWAIF PLQDLLILKE    1080
EYTTRPAKEE TINDPTNPKH YWRYRVHVTL EALIKDKELT SIIKDLVLGS GRSHPGKHAE    1140
KQVIPESAIA TTEKKQIASG KEKANVATPL NGVPRKEAVA IDSLFCTRGG SVVLSLPSDV    1200
AV*                                                                  1260
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03236PLN032367.0e-43496677194+
pfam02446Glyco_hydro_774.0e-449521126176+
pfam02446Glyco_hydro_778.0e-54658826169+
PLN02950PLN0295002711123918+
PLN03236PLN0323606751133473+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A9e-24649807196361A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1tz7_B1e-20677792208329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A1e-20677792208329A Chain A, Aquifex Aeolicus Amylomaltase
Signal Peptide
Cleavage Site
25
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g20790.1Bradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10026154mCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g007886morange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31442.1-v1.0-hybridmrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma06g15140.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1Phvul.001G117700.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)