y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna00446.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 276 Molecular Weight: 31694.4 Isoelectric Point: 4.9838
ChromosomeChromosome/Scaffold: 2 Start: 2499141 End: 2501078
Descriptionbeta glucosidase 42
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1562660
  SRYLDPIYSGEYPKVMRERLGDRLPIFSKEDKDLLKNSLDFVGLNHYTSRFIAHVKDSPEEGDFYKAQEMERIDKWEGGEIIGEKAASEWLYVVPWGIHK
  VLNYIAQRYNSPPIYITENGMDDEDDDSSPLNEMLDDKLRVSYFKRYLAAVSDAMRDGADVRGYFAWSLLDNFEWAQGYTKRFGLVYIDYKNGLSRHPKS
  SAYWFSRFLKN
Full Sequence
Protein Sequence     Length: 276     Download
MKHLNELHSS CIGALNSFKS SFSSAPSANS GSWLDEFKSF SLPFYCLEPT STLSESRYLD    60
PIYSGEYPKV MRERLGDRLP IFSKEDKDLL KNSLDFVGLN HYTSRFIAHV KDSPEEGDFY    120
KAQEMERIDK WEGGEIIGEK AASEWLYVVP WGIHKVLNYI AQRYNSPPIY ITENGMDDED    180
DDSSPLNEML DDKLRVSYFK RYLAAVSDAM RDGADVRGYF AWSLLDNFEW AQGYTKRFGL    240
VYIDYKNGLS RHPKSSAYWF SRFLKNGEGR DGKDD*                              300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029985.0e-4159265210+
COG2723BglB2.0e-4158260210+
PLN02814PLN028146.0e-4559265209+
TIGR03356BGL5.0e-5758260205+
pfam00232Glyco_hydro_19.0e-6658266212+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B058264297503A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB3ptq_A058264297503A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB3ptm_B058264297503A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB3ptm_A058264297503A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB3ptk_B058264297503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.124evm.model.supercontig_88.6
Capsella rubellaCarubv10019488m
Glycine maxGlyma08g15960.3.242.369Glyma08g15960.3.242.369
Linum usitatissimumLus10030515.313.435Lus10026861Lus10020500Lus10020234Lus10030515.313.435
Malus domesticaMDP0000196383MDP0000151948MDP0000292674MDP0000201747.130.258MDP0000201747.130.258
MDP0000205601.303.434MDP0000205601.303.434MDP0000716537
Manihot esculentacassava4.1_028771m.269.395cassava4.1_028771m.269.395cassava4.1_030081m
Panicum virgatumPavirv00007277mPavirv00051180m
Picea abiesMA_10427912g0010MA_10330649g0010MA_10432745g0010
Populus trichocarpaPotri.011G130200.1Potri.001G223200.1
Vitis viniferaGSVIVT01032009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny