y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna00558.1-v1.0-hybrid
FamilyGH28
Protein PropertiesLength: 548 Molecular Weight: 60645.6 Isoelectric Point: 5.6664
ChromosomeChromosome/Scaffold: 6 Start: 19865353 End: 19868034
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281454720
  TSTSTCHVTFPRGGTYLTATIRLKSGVVLNIEDGATLLGGTRLGDYPVEQERWYVVVAENATDVGITGGGVVDGQGLEFVKRFDEKKNVMVSWNSTGACL
  GDECRPRLVGFIDSKNVKLSDIQLRQPAYWCLHIVRCEHVTIQDVSIYGDFNTPNNDGIDIEDSNNTVITRCHIDTGDDAICPKTYTGPLYNLTVTNCWI
  RTKSSAIKLGSASWFDFKGLVFDNITIADSHRGLGFQIRDGGNVSDVIFSNINIRTRYYDPSWWGRAEPIYVTTCPRDSYSKEGSISNILFVNISANSEN
  GVFLSGSKHGLLSDLRFINLNLTFRRRT
Full Sequence
Protein Sequence     Length: 548     Download
MLGDAAAVFS GGKKLESESL REMETLGEPE TVRIRTDYLL FQNLMLTLTR QKDFTPFFLP    60
STRVDLKRTE APSIQMALLL LLQSATLFFP FLLTLLQSTS ATSPSIALPQ NLTPTLSVTD    120
FGATGDGVTY DTFAIQSAID SCSSTSTSTC HVTFPRGGTY LTATIRLKSG VVLNIEDGAT    180
LLGGTRLGDY PVEQERWYVV VAENATDVGI TGGGVVDGQG LEFVKRFDEK KNVMVSWNST    240
GACLGDECRP RLVGFIDSKN VKLSDIQLRQ PAYWCLHIVR CEHVTIQDVS IYGDFNTPNN    300
DGIDIEDSNN TVITRCHIDT GDDAICPKTY TGPLYNLTVT NCWIRTKSSA IKLGSASWFD    360
FKGLVFDNIT IADSHRGLGF QIRDGGNVSD VIFSNINIRT RYYDPSWWGR AEPIYVTTCP    420
RDSYSKEGSI SNILFVNISA NSENGVFLSG SKHGLLSDLR FINLNLTFRR RTNNVGGLVD    480
YRPGCQGLVK HSIAGFILEH INGLVFDSVY MRWSDEQIRQ WNNPMDFRSA TVNNISLLNF    540
HSSLYTQ*                                                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12708Pectate_lyase_31.0e-811717358+
PLN03003PLN030038.0e-11116395336+
pfam00295Glyco_hydro_288.0e-12250452218+
PLN02218PLN022183.0e-14115452369+
COG5434PGU15.0e-37116399318+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2uvf_B2e-1896399141488A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1), Apo Form
PDB2uvf_A2e-1896399141488A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1), Apo Form
PDB2uve_B2e-1896399141488A Chain A, Structure Of Yersinia Enterocolitica Family 28 Exopolygalacturonase
PDB2uve_A2e-1896399141488A Chain A, Structure Of Yersinia Enterocolitica Family 28 Exopolygalacturonase
PDB3jur_D1e-1610939521316A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00836.1
Arabidopsis lyrata324272
Arabidopsis thalianaAT3G57790.1
Brachypodium distachyonBradi4g33660.1
Brassica rapaBra035299
Carica papayaevm.TU.contig_34124.1
Capsella rubellaCarubv10019007m
Chlamydomonas reinhardtiiCre12.g556350.t1.3
Citrus clementinaCiclev10005155mCiclev10004869m
Citrus sinensisorange1.1g038762m
Cucumis sativusCucsa.242950.1
Eucalyptus grandisEucgr.K01816.4Eucgr.K01816.1Eucgr.K01816.3Eucgr.K01816.2
Glycine maxGlyma19g32550.1
Gossypium raimondiiGorai.006G139700.1
Linum usitatissimumLus10026318Lus10042350
Malus domesticaMDP0000248311
Manihot esculentacassava4.1_024146m
Medicago truncatulaMedtr7g092470.1
Mimulus guttatusmgv1a005515m
Oryza sativaLOC_Os09g31270.1
Panicum virgatumPavirv00061210mPavirv00068607m
Physcomitrella patensPp1s116_9V6.1Pp1s375_23V6.1
Phaseolus vulgarisPhvul.001G138000.1
Populus trichocarpaPotri.016G051200.1
Prunus persicappa005960m
Ricinus communis27810.m000670
Setaria italicaSi029777m
Selaginella moellendorffii437695105243
Sorghum bicolorSb02g028280.1
Thellungiella halophilaThhalv10005936m
Vitis viniferaGSVIVT01033349001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny