y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna00661.1-v1.0-hybrid
FamilyGH16
Protein PropertiesLength: 305 Molecular Weight: 33766.3 Isoelectric Point: 7.8769
ChromosomeChromosome/Scaffold: 4 Start: 26692036 End: 26693269
Descriptionxyloglucan:xyloglucosyl transferase 33
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16582238.3e-22
  SNVQVTGNGSMATLVLDKSSGSGLASVNKYHYGFFSAAIKLPPGDSSGVVLSNADVFPHNHDEIDIELLGHDKRNEWVIQTNMYANGSVSTGREEKFYLW
  FDPTTQHHQYTIIWNNYHAVFLVDNIPVREFEHKSSFFPSKPMTVYATIWDGSEWATHGGKYPVNY
Full Sequence
Protein Sequence     Length: 305     Download
MAFLQGKLVF LCLLVLCMSS VLASSRKRRY TSPSVPRLTD AFPHVSISNV FSKAFGGSNV    60
QVTGNGSMAT LVLDKSSGSG LASVNKYHYG FFSAAIKLPP GDSSGVVLSN ADVFPHNHDE    120
IDIELLGHDK RNEWVIQTNM YANGSVSTGR EEKFYLWFDP TTQHHQYTII WNNYHAVFLV    180
DNIPVREFEH KSSFFPSKPM TVYATIWDGS EWATHGGKYP VNYKNAPFTV SFAEMEISGC    240
ISNPSASAPS CSKTSSSLDP VEGPEFVKLT NQQVSAMDWA RGKLMFYSYC KDTSRFKVMP    300
PECK*                                                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00413Glyco_hydrolase_163.0e-1658214171+
cd02183GH16_fungal_CRH1_transglycosylase7.0e-1759229186+
pfam00722Glyco_hydro_163.0e-5255224175+
PLN03161PLN031617.0e-5741303281+
cd02176GH16_XET6.0e-11342303270+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2uwc_B05730328271A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2uwc_A05730328271A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2uwa_C05730331274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
PDB2uwa_B05730331274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
PDB2uwa_A05730331274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
Signal Peptide
Cleavage Site
23
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00577.1Aquca_005_00577.2Aquca_062_00008.1Aquca_002_00238.1Aquca_030_00052.1
Arabidopsis lyrata484102471659858766473398471170
484893
Arabidopsis thalianaAT1G14720.1AT2G01850.1AT4G18990.1AT1G32170.1AT1G10550.1
AT3G44990.1
Brachypodium distachyonBradi1g68590.1Bradi4g29707.1Bradi3g02700.1Bradi3g52307.1Bradi1g01150.1
Bradi1g27867.1Bradi3g34227.1Bradi1g77990.1
Brassica rapaBra026630Bra024848Bra026809Bra013367Bra012559
Bra035513Bra018433Bra037614Bra019416Bra005238
Bra017220
Carica papayaevm.model.supercontig_2.137evm.model.supercontig_208.1evm.model.supercontig_1.14evm.model.supercontig_102.19
Capsella rubellaCarubv10017602mCarubv10009442mCarubv10006389mCarubv10009628mCarubv10009787m
Carubv10017750mCarubv10023595m
Citrus clementinaCiclev10001649mCiclev10015872mCiclev10032164mCiclev10028945mCiclev10012353m
Ciclev10024263m
Citrus sinensisorange1.1g018153morange1.1g021601morange1.1g019909morange1.1g021307morange1.1g022492m
orange1.1g020504morange1.1g036126m
Cucumis sativusCucsa.261710.1Cucsa.261710.2Cucsa.312820.1Cucsa.011980.1Cucsa.292650.1
Cucsa.285970.1Cucsa.385760.1Cucsa.306660.1
Eucalyptus grandisEucgr.B02660.1Eucgr.G02075.1Eucgr.D02229.1Eucgr.E00225.1Eucgr.B03348.1
Eucgr.J00383.1Eucgr.B03937.1Eucgr.A01661.1
Fragaria vescamrna13718.1-v1.0-hybridmrna09672.1-v1.0-hybrid
Glycine maxGlyma01g01770.1Glyma09g34140.1Glyma20g01520.1Glyma07g27990.1Glyma08g09940.1
Glyma05g26960.1Glyma18g18931.1Glyma11g19920.1Glyma12g08520.1Glyma13g39710.1
Glyma12g30200.1Glyma03g34170.1Glyma19g36870.1Glyma13g20450.1Glyma10g06140.1
Gossypium raimondiiGorai.005G153200.1Gorai.013G032000.1Gorai.004G182100.1Gorai.004G182100.4Gorai.008G223600.1
Gorai.009G414100.1Gorai.003G145700.1Gorai.006G162400.1Gorai.009G110900.1Gorai.004G231400.1
Gorai.007G373000.1
Linum usitatissimumLus10029000Lus10030760Lus10013240Lus10010427Lus10041341
Lus10029165Lus10013000Lus10037377Lus10021422Lus10016144
Lus10023009Lus10026535Lus10013822Lus10001396Lus10026536
Malus domesticaMDP0000139485MDP0000292695MDP0000311765MDP0000233177MDP0000208105
MDP0000180043MDP0000302385MDP0000209964
Manihot esculentacassava4.1_011563mcassava4.1_011497mcassava4.1_013982mcassava4.1_012162mcassava4.1_023740m
cassava4.1_013096mcassava4.1_012970mcassava4.1_013124mcassava4.1_013358m
Medicago truncatulaMedtr5g029100.1CU633465_13.1Medtr7g102260.1Medtr2g095800.1
Mimulus guttatusmgv1a019128mmgv1a023829mmgv1a008549mmgv1a011053mmgv1a009338m
mgv1a021958mmgv1a023121m
Oryza sativaLOC_Os10g02770.1LOC_Os03g13570.1LOC_Os09g23220.1LOC_Os02g03550.1LOC_Os03g63760.1
LOC_Os02g46910.1LOC_Os07g29750.1LOC_Os10g39840.1LOC_Os10g42670.1LOC_Os03g01800.1
LOC_Os02g57770.1
Panicum virgatumPavirv00032587mPavirv00052620mPavirv00046314mPavirv00050471mPavirv00029782m
Pavirv00064533mPavirv00064083mPavirv00016440mPavirv00017969mPavirv00066632m
Physcomitrella patensPp1s74_19V6.1Pp1s5_240V6.1
Phaseolus vulgarisPhvul.002G136200.1Phvul.003G014400.1Phvul.002G182000.1Phvul.003G052400.1Phvul.011G085200.1
Phvul.005G130900.1Phvul.007G148500.1Phvul.001G179900.1
Picea abiesMA_2873g0010MA_358917g0010MA_10429722g0010MA_12969g0010MA_306910g0010
MA_20669g0010MA_75919g0010MA_6179g0010MA_177431g0020MA_585083g0010
MA_10181547g0010MA_11511g0010
Populus trichocarpaPotri.001G136100.1Potri.010G102300.1Potri.008G138400.2Potri.008G138400.3Potri.008G138400.1
Potri.003G097300.1Potri.003G097300.2Potri.014G115000.1Potri.009G006600.1Potri.006G122900.1
Potri.016G098600.1
Prunus persicappa008275mppa007685mppa009090mppa007943mppa009437m
Ricinus communis30068.m00265729968.m00065929589.m00124627964.m00034930078.m002269
Setaria italicaSi036533mSi019429mSi030380mSi035702mSi030594m
Si039252mSi017659mSi036387mSi038925m
Selaginella moellendorffii11526656616232041
Sorghum bicolorSb01g041510.1Sb04g002290.1Sb02g024120.1Sb02g033240.1Sb04g031050.1
Sb01g000710.1Sb01g027960.1Sb01g030140.1Sb01g050070.1
Thellungiella halophilaThhalv10008160mThhalv10004560mThhalv10008109mThhalv10008234mThhalv10002627m
Vitis viniferaGSVIVT01013055001GSVIVT01011603001GSVIVT01020228001GSVIVT01031486001GSVIVT01033658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)