y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna00939.1-v1.0-hybrid
FamilyGT47
Protein PropertiesLength: 464 Molecular Weight: 52560.4 Isoelectric Point: 9.3594
ChromosomeChromosome/Scaffold: 2 Start: 6350261 End: 6353888
DescriptionExostosin family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47903860
  LKIYVYDEREIDGLKALMSGRDGAIDSSSCLKGQWGTQVKIHRLLQESRFRTRKKEEADLFFVPTYTKCVRMLGGLNDKEINQTYVKVLRQMPYFKRSGG
  RDHIFVFPSGAGAHLFRSWAKFINRSIILTPEGDRTDKKDTSAFNTWKDIIIPGNVDDGMTTDGATLVHPLPLSKRKYLANYLGRAQGKAGRLKLIELSK
  KFPDKLECPELKFSGPDKLGKIDYFEHLRNAKFCLAPRGESSWTLRFYESFFVECVPVILSDEVELPFQNVVDYTQISIKWPSTRIGPELLQYLESI
Full Sequence
Protein Sequence     Length: 464     Download
MLGSTNNKAR PYSAQHHQQP LCTRKHQIGA LFLVAATVFF TKLLDSSLPC SSSSFTADPL    60
ATTSRSSSVH VTNGGDLLWP QRGYGPVVDL KIYVYDEREI DGLKALMSGR DGAIDSSSCL    120
KGQWGTQVKI HRLLQESRFR TRKKEEADLF FVPTYTKCVR MLGGLNDKEI NQTYVKVLRQ    180
MPYFKRSGGR DHIFVFPSGA GAHLFRSWAK FINRSIILTP EGDRTDKKDT SAFNTWKDII    240
IPGNVDDGMT TDGATLVHPL PLSKRKYLAN YLGRAQGKAG RLKLIELSKK FPDKLECPEL    300
KFSGPDKLGK IDYFEHLRNA KFCLAPRGES SWTLRFYESF FVECVPVILS DEVELPFQNV    360
VDYTQISIKW PSTRIGPELL QYLESIPDEI IEGMISHGRQ VRCLWAYASE SASCSAMHAI    420
LWELQRKVRL FHQSTETFWL HDGSIVNRNL VKFSDWRPPM PLP*                     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin2.0e-4590386310+
Gene Ontology
GO TermDescription
GO:0016020membrane
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brachypodium distachyonBradi5g20997.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Glycine maxGlyma14g38290.1
Gossypium raimondiiGorai.005G082700.1Gorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4
Gorai.005G082700.5
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_011268mcassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Phaseolus vulgarisPhvul.001G063800.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny