y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna00944.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 337 Molecular Weight: 35899.6 Isoelectric Point: 8.2981
ChromosomeChromosome/Scaffold: 6 Start: 9819053 End: 9820683
Descriptionpectin methylesterase 44
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8133110
  NVVVSQDGKGNFKKIMDAIAAAPSQLSSKHFVILVKKGVYKEYVNIGNTKSNIVLIGEGKDATIISGSKSVGGGQATFDTATFAVRAQGFVAMDIGFENT
  ADPKSGQAVAVQSSGDHSVFYRCKISGNQDTLLVQAGRQFFRECQIIGSIDFIFGYGTAVFQKCDIYIKKSQIGGTTVITANGRNSSTDSSGFSFQFCTI
  HGDPQSPTGPTFVTPRGVYLGRSWGTYARTVFMQSSISSILSPQGWLQWNDVPVDKLYFGEYQNSGPGAALGGRVTWPGFHKMSAADADKFTVVKFIDG
Full Sequence
Protein Sequence     Length: 337     Download
MELDDVKIAT TPNVVVSQDG KGNFKKIMDA IAAAPSQLSS KHFVILVKKG VYKEYVNIGN    60
TKSNIVLIGE GKDATIISGS KSVGGGQATF DTATFAVRAQ GFVAMDIGFE NTADPKSGQA    120
VAVQSSGDHS VFYRCKISGN QDTLLVQAGR QFFRECQIIG SIDFIFGYGT AVFQKCDIYI    180
KKSQIGGTTV ITANGRNSST DSSGFSFQFC TIHGDPQSPT GPTFVTPRGV YLGRSWGTYA    240
RTVFMQSSIS SILSPQGWLQ WNDVPVDKLY FGEYQNSGPG AALGGRVTWP GFHKMSAADA    300
DKFTVVKFID GDSWLPALGI PHSQGLDPLA NPPMGA*                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02506PLN025065.0e-10512326317+
PLN02713PLN027132.0e-10614326316+
PLN03043PLN030431.0e-10614326316+
PLN02201PLN022016.0e-11911326318+
pfam01095Pectinesterase2.0e-13813312303+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A0123267319A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0133264315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B3e-2893181341A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A3e-2893181341A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B1e-2793181341A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_033_00002.1Aquca_011_00390.1
Carica papayaevm.model.supercontig_116.69evm.model.supercontig_116.68
Capsella rubellaCarubv10003619m
Citrus clementinaCiclev10003835mCiclev10003723mCiclev10003299m
Citrus sinensisorange1.1g042946m
Fragaria vescamrna30095.1-v1.0-hybrid
Malus domesticaMDP0000217465MDP0000151159MDP0000258482MDP0000139083
Manihot esculentacassava4.1_022889mcassava4.1_021757mcassava4.1_022356m
Panicum virgatumPavirv00005884mPavirv00056856mPavirv00010344m
Prunus persicappa014833m
Setaria italicaSi015000mSi004506mSi033284m
Selaginella moellendorffii431592
Sorghum bicolorSb02g028740.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny