y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna01325.1-v1.0-hybrid
FamilyGT8
Protein PropertiesLength: 2126 Molecular Weight: 239883 Isoelectric Point: 5.1805
ChromosomeChromosome/Scaffold: 6 Start: 1946890 End: 1961413
DescriptionSIN3-like 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT8182720880
  VHVAMTIDSEYLRGTIAAVHSVLKHASCPQNTFFHFIASDSSPVSSQDLTRVVHSTFPSLRFRVYQFKESIVSHLISSSIRQALDNPLNYARSYLADLLD
  ACVERVIYLDSDVIVVDDVEKLWRIKLSGSRVIGAPEYCHANFTKYFSDGFWEDSEMSKVFEGKSACYFNTGVMVMDLVRWREGDYTRKIESWMEIQKEK
  RIYELGSLPPFLLVFGGDVEAIHHRWNQHGLGGDNVVNSCRSLHPGPVSLLHWSGKGKPWSR
Full Sequence
Protein Sequence     Length: 2126     Download
MKRIRDDVYS GGGSGGGAGG GSSQLKRPLA SSRGDSNGPP QVQGGGGGVV GGVASVGVVS    60
VGVAASQKLT TNDALTYLKE VKDMFQDQRE KYEMFLEVMK DFKAQRTDTT GVIARVKELF    120
KGHTKLILGF NTFLPKGYEI TLEEVEPKKT VEFEEAISFV NKIKKRFQND EQVYKSFLDI    180
LNMYRKEHKD INEVYQEVAS LFDDQPDLLD EFTRFLPDTS ATTSTHQGQY GRNPYPRFNE    240
RSSATPTLRP MPIDKQRRRD KITSHGDHDI SVDRPELDDD KGMIKVLKEQ RKRFPEKENR    300
DRRNRDHEDR EVETDNNRDY NLQRFPEKRK SSRKVDGFGA NANFSPYDDK DTLKGKYSQA    360
FGFFEKVKER LCSQDDYQTF LKFLHIYSNG IIKRNDLQNM VTDLLKHPDL MEEFNEFLER    420
CENIESVGSD GHLSRSVKLE DKDKEPKREM EGVKEKERYR EKYWAKSIQE LDLSNCERCT    480
PSYRLLPEDY PIPSASQRSE LAAQVLNDHW VSVTSGSEDY SFKHMRRNQY EESLFRCEDD    540
RFELDMLLES VSSTCKRAEE LLNSMNENKL SMETQIHIED HFIALNTRCI ERLYGDHGLD    600
VMDILRKSPT LALPVILTRL KQKQEEWTRC RVDFNKVWAD IYAKNHYKSL DHRSFYFKQQ    660
DSKNLSSKYL VAEIKELKDK KQIEDDILLA VAAGNRQSIV PHLEYEYLDV SIHEDLYKLV    720
EYSSEELSST KEQLSKTMRL YTTFLEPMLG IPSRPHGSED DEDVDKTRKL AMTCSASSNG    780
ESDGSPGGDT TMVNFKQPKS GGNEDENALA EVASSRTTLA NGDTLAKEDG SCDADNPGRD    840
DSICNNIRVE KEQKNMGISD KMHGPSKPIV SIDRVGNSNA SFAIGGENNH GRISMEVTSG    900
SVATTSRPYD SISENEQSKK TIADTAVPSS EGGDTAKPAS FGIGVFTEST KVNSRHEESI    960
GPSKIEKEEG ELSPIGDYGE DNFVVSGDAV QALPKGNHGV ERQYQSGNGE EICPQDAGEN    1020
DADADDENSE NVSEAGEDVS GSETAGDECS REEHGEEDAE HDDVDGKAES EGEAEGMADG    1080
HLVGDSCSLQ LPERFLMSVK PLAKHVSEPL VDDKKDCRVF YGNDNFYVLY RLHQILYERI    1140
LAAKTNSVGA ETKWRTSKDG NPPDLYGRFM SALYNLLDGS ADNAKFEDEC RAIIGNQSYV    1200
LFTLDKLIYK FVKQLQAVAT DEMDNKLLHL YEYEKSRKKG KLIDSVYFEN TRVLVHEENI    1260
YRLEFHSAPS RLSIQLMDSV SEKPEASAVS MEPNFSSYLH NDFLSLYPGK KEPHGITLQR    1320
NKRKFAGQDE SSAFSNAMEG VQLVNGLECK IACNSSKISY VLDTEDYFFR MRRKRRMSSE    1380
SRSPYCDQTR GFSDSEITMD SISSSCSPAI PKDLAKKKRT NRLAKLKQSK LDVRREQWLS    1440
HVKNKGHKVN SDRNEGSPTS FMHVDNERKI LLDNLETSST GGSIDNSSIH DSDVESLMNS    1500
PCESSLDRSD SVKNLNESSN GGCPENVSKE DPDDGCLDDW EAVADALTAD DNQHNNLFGF    1560
PATTEMRVEP TGPELCIENP VAELSKPENR NIVPESRVNT CAWRPNDASR PQSLPNLSKE    1620
HSFPVQSDWH CGHGAIAWTW QSIVPQPSSC PICYEDLDIT DSSFLPCSCG FRLCLFCHKR    1680
ILEADGRCPG CRKQYDRVNE VMSFNGGATT FRNNENAEYS DRTELESLSE SQLLYDVAYV    1740
NLVVSRQLAE AIVLVLVVEG PTIFLVLFFF LLSLITFTPA NAIRSFPERV GISFLQQFSE    1800
APEYKNGFSC RVLGVGNFPA ACDPSLVHVA MTIDSEYLRG TIAAVHSVLK HASCPQNTFF    1860
HFIASDSSPV SSQDLTRVVH STFPSLRFRV YQFKESIVSH LISSSIRQAL DNPLNYARSY    1920
LADLLDACVE RVIYLDSDVI VVDDVEKLWR IKLSGSRVIG APEYCHANFT KYFSDGFWED    1980
SEMSKVFEGK SACYFNTGVM VMDLVRWREG DYTRKIESWM EIQKEKRIYE LGSLPPFLLV    2040
FGGDVEAIHH RWNQHGLGGD NVVNSCRSLH PGPVSLLHWS GKGKPWSRLD LGKPCLVDYL    2100
WAPYDLYIHH HHHHHHHHEQ LLAVL*                                         2160
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5602SIN30.000134341878+
COG5602SIN34.0e-715521763+
COG5602SIN31.0e-711201277160+
COG5602SIN34.0e-176914072+
COG5602SIN34.0e-66147681542+
Gene Ontology
GO TermDescription
GO:0005634nucleus
GO:0006355regulation of transcription, DNA-dependent
GO:0016757transferase activity, transferring glycosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rms_A3e-1967137171B Chain B, Solution Structure Of The Msin3a Pah1-Sap25 Sid Complex
PDB2rms_A0.0000002149217169B Chain B, Solution Structure Of The Msin3a Pah1-Sap25 Sid Complex
PDB2rmr_A3e-1967137171A Chain A, Solution Structure Of Msin3a Pah1 Domain
PDB2rmr_A0.0000002149217169A Chain A, Solution Structure Of Msin3a Pah1 Domain
Transmembrane Domains
StartEnd
17521774
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00358.1Aquca_017_00377.1Aquca_007_00136.1Aquca_002_01104.1Aquca_010_00404.1
Aquca_026_00195.1Aquca_003_00612.1Aquca_002_00392.1
Arabidopsis lyrata486764490360476133905093906411
472678470231477926472152471480
Arabidopsis thalianaAT3G62660.1AT4G02130.3AT4G02130.2AT4G02130.1AT3G50760.1
AT3G28340.1AT1G70090.2AT1G70090.1AT1G24170.1AT1G02720.2
AT1G02720.1AT3G06260.1AT1G19300.1AT1G13250.1
Brachypodium distachyonBradi1g64830.1Bradi1g61830.1Bradi5g16690.1Bradi1g12560.1Bradi3g59760.1
Bradi1g44470.1
Brassica rapaBra041026Bra003504Bra025325Bra030163Bra016237
Bra039058Bra012890Bra012417Bra024642Bra020762
Bra032589Bra001188Bra016512Bra025726Bra019820
Bra040231
Carica papayaevm.model.supercontig_37.85evm.model.supercontig_151.46evm.model.supercontig_16.63evm.model.supercontig_5.324evm.model.supercontig_14.73
evm.model.supercontig_1.221evm.model.supercontig_9.124
Capsella rubellaCarubv10017525mCarubv10017523mCarubv10020432mCarubv10018870mCarubv10018975m
Carubv10011392mCarubv10001309mCarubv10015151mCarubv10009529mCarubv10012618m
Carubv10010952m
Citrus clementinaCiclev10020715mCiclev10001658mCiclev10031574mCiclev10031831mCiclev10025952m
Ciclev10020857mCiclev10015791m
Citrus sinensisorange1.1g017643morange1.1g042515morange1.1g047424morange1.1g018567morange1.1g018535m
orange1.1g023261m
Cucumis sativusCucsa.205260.1Cucsa.096860.1Cucsa.342110.1Cucsa.101770.1Cucsa.232430.1
Cucsa.285670.1Cucsa.283880.1Cucsa.084880.1
Eucalyptus grandisEucgr.A00485.1Eucgr.B02574.1Eucgr.B03054.1Eucgr.K03408.1Eucgr.H01923.1
Eucgr.I01882.1Eucgr.H01534.1Eucgr.F01531.1
Fragaria vescamrna03873.1-v1.0-hybridmrna29514.1-v1.0-hybridmrna00730.1-v1.0-hybridmrna15079.1-v1.0-hybridmrna06069.1-v1.0-hybrid
mrna27629.1-v1.0-hybrid
Glycine maxGlyma10g01960.1Glyma02g01880.2Glyma02g01880.1Glyma17g36650.1Glyma06g03770.1
Glyma01g38520.1Glyma04g03690.1Glyma02g11100.1Glyma02g06640.1Glyma01g22480.1
Glyma14g08430.1Glyma07g38430.1Glyma17g02330.1Glyma02g03090.1Glyma19g01910.1
Glyma03g37560.1Glyma19g40180.1Glyma01g04460.1Glyma13g04780.1
Gossypium raimondiiGorai.001G142100.1Gorai.007G125600.5Gorai.007G125600.4Gorai.007G125600.3Gorai.007G125600.2
Gorai.007G125600.1Gorai.009G274300.1Gorai.008G142800.3Gorai.008G142800.2Gorai.008G142800.1
Gorai.009G094500.1Gorai.003G017900.1Gorai.009G205300.1Gorai.007G207000.2Gorai.007G207000.1
Gorai.005G187600.1Gorai.002G129800.1Gorai.009G345300.1Gorai.010G012700.1Gorai.009G094500.2
Gorai.007G133400.1Gorai.011G181200.1Gorai.008G070000.1Gorai.005G106100.2Gorai.005G106100.1
Gorai.012G058400.1
Linum usitatissimumLus10010727Lus10029215Lus10010025Lus10016301Lus10032728
Lus10018801Lus10002440Lus10030821Lus10013296Lus10012765
Lus10034012Lus10041489Lus10034274Lus10000262Lus10001461
Malus domesticaMDP0000794936MDP0000146240MDP0000856834MDP0000370712MDP0000401001
MDP0000185643MDP0000489408MDP0000678218MDP0000518347MDP0000124674
MDP0000467113MDP0000862557MDP0000534564MDP0000315192MDP0000120125
MDP0000190839MDP0000738777MDP0000282390MDP0000234929MDP0000261375
MDP0000745582
Manihot esculentacassava4.1_009251mcassava4.1_010284mcassava4.1_010677mcassava4.1_030032mcassava4.1_010644m
cassava4.1_010619mcassava4.1_030190mcassava4.1_010034mcassava4.1_032470mcassava4.1_027013m
cassava4.1_010840mcassava4.1_027039mcassava4.1_027652m
Medicago truncatulaMedtr6g008900.1Medtr4g071620.1Medtr8g078240.1Medtr7g109210.1Medtr3g092310.1
Medtr5g019220.1Medtr5g036580.1Medtr1g089820.1
Mimulus guttatusmgv1a027115mmgv1a019931mmgv1a006996mmgv1a025873mmgv1a009253m
mgv1a009521mmgv1a022129mmgv11b016267mmgv1a012428mmgv1a023917m
Oryza sativaLOC_Os03g18890.1LOC_Os04g44850.1LOC_Os02g50600.1LOC_Os06g13760.1LOC_Os03g47530.1
LOC_Os03g24510.1LOC_Os07g45260.1LOC_Os10g31650.1
Panicum virgatumPavirv00013322mPavirv00014799mPavirv00024693mPavirv00043544mPavirv00057337m
Pavirv00044356mPavirv00029444mPavirv00011574mPavirv00060955mPavirv00006973m
Pavirv00012530mPavirv00040941mPavirv00040847mPavirv00030626mPavirv00044928m
Physcomitrella patensPp1s4_405V6.1Pp1s129_133V6.1Pp1s229_15V6.2Pp1s229_15V6.1Pp1s281_1V6.1
Pp1s43_42V6.1Pp1s44_257V6.1Pp1s78_207V6.2Pp1s78_207V6.1Pp1s10_51V6.2
Pp1s10_51V6.1Pp1s29_210V6.1
Phaseolus vulgarisPhvul.007G217100.1Phvul.009G055600.1Phvul.003G097800.1Phvul.002G026000.1Phvul.003G251200.1
Phvul.001G016900.1Phvul.003G027400.1Phvul.007G168700.1Phvul.002G077400.1Phvul.001G211100.1
Phvul.004G022700.1
Picea abiesMA_10432403g0010MA_130934g0010MA_88535g0010MA_766299g0010MA_10429227g0010
Populus trichocarpaPotri.010G038300.1Potri.014G040300.1Potri.002G200200.1Potri.008G116900.1Potri.002G132900.1
Potri.014G125000.1Potri.007G031700.1Potri.010G129400.1Potri.005G128000.1Potri.008G018100.1
Potri.008G192600.1Potri.010G242300.1
Prunus persicappa007216mppa007794mppa007777mppa006911mppa007313m
ppa021809mppa007162mppa008099m
Ricinus communis29822.m00342329703.m00153930170.m01398729738.m00104829250.m000233
29736.m00210429726.m00393729986.m001675
Setaria italicaSi039250mSi012092mSi017541mSi006389mSi036413m
Si040204mSi030368m
Selaginella moellendorffii234804437525
Sorghum bicolorSb01g037870.1Sb06g023460.1Sb10g008830.1Sb04g028460.1Sb01g012060.1
Sb02g041310.1Sb01g034770.1
Thellungiella halophilaThhalv10006057mThhalv10006055mThhalv10028760mThhalv10028758mThhalv10004449m
Thhalv10018687mThhalv10008011mThhalv10007867mThhalv10021020mThhalv10010596m
Thhalv10008059mThhalv10007975m
Vitis viniferaGSVIVT01028072001GSVIVT01020141001GSVIVT01009639001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)