y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna01394.1-v1.0-hybrid
FamilyGH38
Protein PropertiesLength: 2500 Molecular Weight: 316271 Isoelectric Point: 6.5152
ChromosomeChromosome/Scaffold: 6 Start: 38026716 End: 38046620
DescriptionGlycosyl hydrolase family 38 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38105513730
  NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKSRKFVYVEIAFFQRWWREQSDAVQRITKDLVSSGQLEFINGGMCMHDEAAT
  HYVDMVDQTTLGHRFLKREFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKNEKSLEFVWRGSKSLGSSAEIFSGAFPENYEPPS
  GFYFEVNDPSPIDDITLFDYNVQERVNDFIAAAVKQYLTAVIYSQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDA
  KYASNESWPIKTDDFFPYA
GH38373480
  NVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVIDSVISSLLEDKNRKFIYVEIAFFQRWWRQQSPALKIKVKELVSSGQLEFINGGMCMHDEATA
  HYIDLIDQTTLGHQFILKEFGQTPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAVRLRDKTLEVIWQGCKSLASSSQIFTGIFPKHYDPPD
  GFVFEINDVSPPIQDDILLFDYNVQERVNNFVAAALAQANVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNQDARVNAFYSTPSIYTDAKYAADEQ
  WPLKTDDFFPYA
Full Sequence
Protein Sequence     Length: 2500     Download
MASALLLLVV LLAGLLAAQS EYIAYNTTAG IVPEKLNVHL VPHSHDDVGW LKTVDQYYVG    60
ANNSIRGACV QNVIDSVISS LLEDKNRKFI YVEIAFFQRW WRQQSPALKI KVKELVSSGQ    120
LEFINGGMCM HDEATAHYID LIDQTTLGHQ FILKEFGQTP RVGWQIDPFG HSAVQAYLLG    180
AELGFDSLFF ARIDYQDRAV RLRDKTLEVI WQGCKSLASS SQIFTGIFPK HYDPPDGFVF    240
EINDVSPPIQ DDILLFDYNV QERVNNFVAA ALAQANVTRT NHIMWLMGTD FRYQYANSWF    300
RQMDKFIHYV NQDARVNAFY STPSIYTDAK YAADEQWPLK TDDFFPYADH PNAYWTGYFT    360
SRPAFKGYVR ILSGYYLAAR QLEFFKGRSD SGPNTDALAD ALAIVQHHDA VSGTQRQHVA    420
ADYAMRLSIG YLEAEKVVAS SLAYLSDSEP SSGQKRTATK FEQCPLLNIS YCPPSEAALS    480
DGKSLVVVIY NPLGWKREEV IRIPVSYESV TVQDSTQRKI EAQLLPLSNA TLKLRSYYVG    540
AHLGNTPSEP PKYWLAFSVT VPPLGFSSYV ISSAKQTDKD RSSTVSTVYT SEGNTNKTIE    600
VGQGSLKLLY SADEGKLARY INSRYKVTAV AEQSYSYYTG NDGTDKDPQA SGAYVFRPNN    660
TVVIKSEEKV SLTLMRGPVL DEVHQQINQW VSQITRLYKG KEHAEVEFTI GPIPVDDGFG    720
KEITTQFTTA MKTNKTFYTD SNGRDFIKRV RDFRTDWDLQ VNQPIAGNYY PINLGIYVQD    780
SSTELSVLVD RAVGGTSLVD GQVELMLHRR LIHDDIRGVG EVLNETVCIS DKCEGLTVQG    840
KFYLRIDPLG EGSKWRRTAG QEISVPLLLA FAEQEGNDWM NSHVPTFSGI DPSYALPDNV    900
AVITLQELGN GKVLLRLAHL YETGEDKDYS VLANVELKKL FPRKKISKVT ETSLSANQER    960
GEMEKKRLVW KVEGSKESKV VRGGAVDPAK LVVELAPMEI RTFLIDLEYL HIYVRARMAT    1020
KTPGLLFFLA LLLLVADSKF MVYETSQGIV PGKLNVHLVP HTHDDVGWLK TVDQYYVGSN    1080
NSIQGACVQN VLDSLIPALL ADKSRKFVYV EIAFFQRWWR EQSDAVQRIT KDLVSSGQLE    1140
FINGGMCMHD EAATHYVDMV DQTTLGHRFL KREFNVTPRI GWQIDPFGHS AVQAYLLGAE    1200
VGFDSLFFGR IDYQDREKRK NEKSLEFVWR GSKSLGSSAE IFSGAFPENY EPPSGFYFEV    1260
NDPSPIDDIT LFDYNVQERV NDFIAAAVKQ YLTAVIYSQA NITRTNHIMW TMGTDFKYQY    1320
AHTWFRQMDK LIHYVNKDGR VNALYSTPSI YTDAKYASNE SWPIKTDDFF PYADRINAYW    1380
TGYFTSRPAL KHYVRTMSGY YLCNDIFRLT YLYGLLDNKA ARQLEFFKGR SNSGPNTDSL    1440
ADALAIAQHH DAVTGTEKQH VANDYAKRLS IGYMESEELV ATSLAHLVES ASGNPTTKFQ    1500
QAKNLEPLSL CACVLLNISY CPSSEVTLSQ GKKLIVVVYN SLGWKRDDTV RIPVVNEAII    1560
VHDSEGKEVK SQLLPLDDVH LGLRNHYVKA YLGQFPNKTP KYWLVFTVSV PPLGFNTYTI    1620
SGAEGAGAST TRSSVYTIQS KEKSTIEVGQ GNVKLTFSTD EGKMINYVNS RSLVEESVQQ    1680
SYSFYNGYNG SYDKPPLIPQ NAGAYIFRPN GSSFVTPEEK VPLTVMQGPV IDEVHQQINS    1740
WIHQVTRLHK EKEHVEVEFI VGPIPINDGI GKEVVTQLNT TMATNKTFYT DSNGRDFIKR    1800
IRDYRTDWDF KVNQPVAGNY YPINLGIYMQ DDKKEFSVLV DRSLGGSSIV DGQIELMLHR    1860
RLLLDDSRGV AEALNETVCV SDECTGLRVL GKLYFRIDPL GDGAKWRRSF GQEIYSPLLL    1920
AFTEQDGDDW KNSHETTFSG IDSSYSLPDN VALITLQELD DGKVLIRLAH LYEVGEDKDF    1980
SVMANVELKK LFPRKKIGKV TEMNLSANQE RTDMERKRLV WKAEEGSSGT AKGVRGGPVD    2040
PAKLVVELAP MEIRTFLIDL EQNLQRHHYH NFMSILPNQN QGSNSSSSSI PFANPNSQHG    2100
NHHDRHLFQP QSLSRQNIAF GSLDISDSHS PTSPGPSLPA PQDSLGSSQE VTELGLADNN    2160
VMPNHERHSQ SRSGGNGRGA GSYRSRGKRS GSQQSIGTVA SHGSSPQPAG RRSQMMNGNH    2220
LLNFHYDPIS RPQARGPPPP PARRQHKRKA YNKDLFLQAN YKFVVLDAGN YSAESMDPDK    2280
MLRWEDIICV RYSTPTLVQC PICLEYPLCP QITSCGHIFC FPCILQYLLM GKEDHKGDSW    2340
KRCPLCFVMI SPKDLYTLFV ENVKQYSVGD STEFMLLSRQ KDSFTISHKI KQEKDAMPGC    2400
DDESYDPFSK FTFTSDVDLS VRKAISELDA WLVRADAGLV DDLEKLPYVC AAMEHLEQRK    2460
KYWNEHRAID NNKTGSSVVL ATANPTNGNS EASIIGDGTL                          2520
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02701PLN027012.0e-9710531872905+
cd00451GH38N_AMII_euk2.0e-10310541337284+
PLN02701PLN027012.0e-1063410081090+
cd10810GH38N_AMII_LAM_like1.0e-16810541337288+
cd10810GH38N_AMII_LAM_like3.0e-17036312279+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7d_A0243182298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1o7d_A0104313433298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1ps3_A012955571015A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB1ps3_A01053187480882A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A012955571015A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Signal Peptide
Cleavage Site
20
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)