y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna01849.1-v1.0-hybrid
FamilyGT2
Protein PropertiesLength: 240 Molecular Weight: 26834.2 Isoelectric Point: 9.7178
ChromosomeChromosome/Scaffold: 5 Start: 5453696 End: 5455540
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291771.4013e-45
  SIIVPTYNERLNIALLVYLVFKHLRDVDFEIIIVDDGSPDGTQLVVQQLQDLYGQDRILLRARPRKLGLGTAYIHGLKHASGDFVVIMDADLSHHPKYLP
  SFIKKQLETNASIVTGTRYVKGGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSALEDI
Full Sequence
Protein Sequence     Length: 240     Download
MEKTKNKYSI IVPTYNERLN IALLVYLVFK HLRDVDFEII IVDDGSPDGT QLVVQQLQDL    60
YGQDRILLRA RPRKLGLGTA YIHGLKHASG DFVVIMDADL SHHPKYLPSF IKKQLETNAS    120
IVTGTRYVKG GGVHGWNLMR KLTSRGANVL AQTLLWPGVS DLTGSFRLYK KSALEDIISS    180
CVSKGYVFQM EMIVRASRKG YHIEEVPITF VDRVYGISKL GGSEIVEYLK GLAYLLVTT*    240
                                                                     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00535Glycos_transf_21.0e-359177170+
cd04188DPG_synthase9.0e-4010212208+
cd04179DPM_DPG-synthase_like2.0e-6810196188+
cd06442DPM1_like2.0e-13110235226+
PLN02726PLN027266.0e-1755239236+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2z86_D0.0000001912896214A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB2z86_C0.0000001912896214A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB2z86_B0.0000001912896214A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00839.1Aquca_007_00839.2
Arabidopsis lyrata889509
Arabidopsis thalianaAT1G20575.1
Brachypodium distachyonBradi2g19800.1
Brassica rapaBra025828Bra012235
Capsella rubellaCarubv10010457mCarubv10010118m
Chlamydomonas reinhardtiiCre03.g150950.t1.1
Citrus clementinaCiclev10003501m
Citrus sinensisorange1.1g026146m
Cucumis sativusCucsa.272070.1Cucsa.272070.2Cucsa.272070.3Cucsa.272070.4
Eucalyptus grandisEucgr.F01769.1
Glycine maxGlyma13g24040.2Glyma07g32560.4Glyma07g32560.3Glyma07g32560.1Glyma13g24040.1
Gossypium raimondiiGorai.005G113700.2Gorai.005G113700.1Gorai.005G113700.3Gorai.005G113700.4Gorai.002G116900.2
Gorai.002G116900.1
Linum usitatissimumLus10013228Lus10030748
Malus domesticaMDP0000284475
Manihot esculentacassava4.1_014960mcassava4.1_014955m
Medicago truncatulaMedtr2g097220.1
Mimulus guttatusmgv1a012434m
Oryza sativaLOC_Os03g60939.1
Panicum virgatumPavirv00006084mPavirv00010357mPavirv00010356mPavirv00041144mPavirv00011250m
Pavirv00010359m
Physcomitrella patensPp1s182_58V6.1
Phaseolus vulgarisPhvul.003G057700.1
Picea abiesMA_10426906g0010MA_158782g0100.50.214MA_159042g1170
Populus trichocarpaPotri.005G250900.1Potri.002G010300.1Potri.005G250900.2
Prunus persicappa010139m
Ricinus communis30170.m014358
Setaria italicaSi039247mSi037228m
Selaginella moellendorffii98270
Sorghum bicolorSb01g002910.1
Thellungiella halophilaThhalv10008599m
Vitis viniferaGSVIVT01008672001
Volvox carteriVocar20000557m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny