y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna02152.1-v1.0-hybrid
FamilyAA1
Protein PropertiesLength: 540 Molecular Weight: 60430.4 Isoelectric Point: 7.2719
ChromosomeChromosome/Scaffold: 2 Start: 8612633 End: 8615346
DescriptionLaccase/Diphenol oxidase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1185240
  VKEATYTRLCSTKKILTVNGKFPGPVLRAYRGDTIYVNVHTGGRHNITIHWHGVRQPRNPWSDGPEYITQCPIQPGGSFNQKIIFSTEEGTLWWHAHSDW
  SRAPVHGAIYVYPKPGTSHPFPKPHAEIPIILGEWWKQDVMKEFQEFVRSGGPPNVSDAYTINGQPGDLYPCSKSVNAIVNEIVFLAVANHNLTVVVVAT
  DASYTKPIETDYITISPGQSMDVLLVTNQQRPGLYYMAARAYNGNPVVGFDTTTTTAIVEYNNGNGNKNDTPLFPYLPGFNDTARAFGFFSRLKSLPVDF
  KEPVPKTIDRRIISTIAINTFPCQGNQTCQGPNGTRLAASMNNISFVEPNTVDILVAYYYYINGVFKKGFPNYPPYAYNFTGQNLPLVLQIPKRGTKVKV
  IEYGTDMEVVFQNTNLVGGLDHPMHLHGFDFYIIGTGFGNFDEQNDPKSYNLVDPPLRNTVTVPISGWDAIRFKANNPGVWYLHCHFDRHLTWGMDTVFI
  VNNGKHK
Full Sequence
Protein Sequence     Length: 540     Download
MEPSEDNFVN ESDSSNLVKE ATYTRLCSTK KILTVNGKFP GPVLRAYRGD TIYVNVHTGG    60
RHNITIHWHG VRQPRNPWSD GPEYITQCPI QPGGSFNQKI IFSTEEGTLW WHAHSDWSRA    120
PVHGAIYVYP KPGTSHPFPK PHAEIPIILG EWWKQDVMKE FQEFVRSGGP PNVSDAYTIN    180
GQPGDLYPCS KSVNAIVNEI VFLAVANHNL TVVVVATDAS YTKPIETDYI TISPGQSMDV    240
LLVTNQQRPG LYYMAARAYN GNPVVGFDTT TTTAIVEYNN GNGNKNDTPL FPYLPGFNDT    300
ARAFGFFSRL KSLPVDFKEP VPKTIDRRII STIAINTFPC QGNQTCQGPN GTRLAASMNN    360
ISFVEPNTVD ILVAYYYYIN GVFKKGFPNY PPYAYNFTGQ NLPLVLQIPK RGTKVKVIEY    420
GTDMEVVFQN TNLVGGLDHP MHLHGFDFYI IGTGFGNFDE QNDPKSYNLV DPPLRNTVTV    480
PISGWDAIRF KANNPGVWYL HCHFDRHLTW GMDTVFIVNN GKHKKEKLLP PPPDMPPCY*    540
                                                                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_31.0e-4218133118+
PLN02191PLN021917.0e-6227517539+
PLN02604PLN026043.0e-6527516532+
TIGR03388ascorbase9.0e-7827516545+
TIGR03389laccase018538539+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B02751619521A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1asq_A02751619521A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1asp_B02751619521A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1asp_A02751619521A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1aso_B02751619521A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)