y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna02178.1-v1.0-hybrid
FamilyGT77
Protein PropertiesLength: 428 Molecular Weight: 48258.4 Isoelectric Point: 9.1358
ChromosomeChromosome/Scaffold: 2 Start: 2780445 End: 2782204
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771824000
  IPNYLVVALDEEIARYCEANNVPVYKRDPDKGIDSVARTGGNHAVSGLKFHILREFLQLGYSVLLSDVDIVYLQNPFNHLYRDSDVESMTDGHNNNTAYG
  FNDVFDEPKMGWARYAHTMRMWVYNSGFFYIRPTIPSIELLDRVAGRLSKQPNSWDQAVFNEELFFPSHPGYDGLHASRRTMDFYLFMNSKVLFKTVRKD
  DNLSKLKPVIVHVNYHPDK
Full Sequence
Protein Sequence     Length: 428     Download
MMGVSRRQNV QSRVGIAIAI GVILGCVFAL CFPNGFISIS NPAPILNRRF AKSIAQVGST    60
LCESSERLNM LKSEFVAASE ENSELKKKVR ELTEKFRLAE QRKDQAEKQV LVLGDQKKAG    120
PFGTVKGLRT NPSVVPDESV NPRLAKVLEK VAVNKEIIVA LANSNVKEML EVWFTNIKRV    180
GIPNYLVVAL DEEIARYCEA NNVPVYKRDP DKGIDSVART GGNHAVSGLK FHILREFLQL    240
GYSVLLSDVD IVYLQNPFNH LYRDSDVESM TDGHNNNTAY GFNDVFDEPK MGWARYAHTM    300
RMWVYNSGFF YIRPTIPSIE LLDRVAGRLS KQPNSWDQAV FNEELFFPSH PGYDGLHASR    360
RTMDFYLFMN SKVLFKTVRK DDNLSKLKPV IVHVNYHPDK LPRMLAVVEF YVNGKQDALK    420
SFPDGSE*                                                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-57182404232+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Transmembrane Domains
StartEnd
1739
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00429.1
Arabidopsis lyrata476651472163476650
Arabidopsis thalianaAT1G19360.1AT1G75120.1AT1G75110.1
Brachypodium distachyonBradi1g15990.1Bradi1g23050.1
Brassica rapaBra016507Bra025734
Carica papayaevm.model.supercontig_62.116evm.model.supercontig_64.63
Capsella rubellaCarubv10021612mCarubv10011112mCarubv10020421mCarubv10021694m
Chlamydomonas reinhardtiiCre12.g552400.t1.3Cre10.g418300.t1.2g11937.t1Cre06.g288500.t1.2Cre02.g111000.t1.2
Citrus clementinaCiclev10001254m
Citrus sinensisorange1.1g014357m
Cucumis sativusCucsa.342160.1Cucsa.240290.1
Eucalyptus grandisEucgr.I01250.1Eucgr.I01251.1Eucgr.I01249.1Eucgr.F01547.1
Fragaria vescamrna15113.1-v1.0-hybrid
Glycine maxGlyma11g12750.1Glyma14g08280.1Glyma12g04930.1Glyma17g36770.2
Gossypium raimondiiGorai.012G146400.1Gorai.012G146400.2Gorai.010G011500.1
Linum usitatissimumLus10026327Lus10032710Lus10042340Lus10018812
Malus domesticaMDP0000152163MDP0000259542MDP0000518381MDP0000208242MDP0000314698
MDP0000242848
Manihot esculentacassava4.1_007950mcassava4.1_008109m
Mimulus guttatusmgv1a006896mmgv1a006728mmgv1a006960m
Oryza sativaLOC_Os07g39840.1
Panicum virgatumPavirv00016039mPavirv00037224mPavirv00044239mPavirv00031762m
Physcomitrella patensPp1s246_43V6.1Pp1s351_31V6.1
Phaseolus vulgarisPhvul.001G015800.1Phvul.011G047000.1
Picea abiesMA_54369g0010
Populus trichocarpaPotri.014G042700.1Potri.014G042700.2Potri.014G042700.3Potri.002G134400.1Potri.009G113300.1
Prunus persicappa006072mppa005997m
Ricinus communis30170.m01400629851.m002438
Setaria italicaSi029932mSi035830m
Selaginella moellendorffii103279431230
Sorghum bicolorSb02g037900.1Sb01g031700.1
Thellungiella halophilaThhalv10007712mThhalv10018600m
Vitis viniferaGSVIVT01009666001GSVIVT01031309001
Volvox carteriVocar20009953mVocar20009597mVocar20012076m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny