y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna02278.1-v1.0-hybrid
FamilyGH116
Protein PropertiesLength: 1066 Molecular Weight: 118018 Isoelectric Point: 6.2206
ChromosomeChromosome/Scaffold: 5 Start: 26422045 End: 26432061
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165549260
  GQFLYLEGVEYHMWNTYDVHFYSSFALVMLFPKLELSIQRDFAAAVMMHDPSKMSVLCDGKLVQRKVLGAVPHDIGIHDPWFEVNAYNVYNTDRWKDLNP
  KFVLQIYRDVVATGDKKFAEAVWPSVYVAMAYMEQFDRDGDGMIENEGFPDQTYDTWSVTGVSAYCGGLWLAALQAASALAREVGDKGSEDYFWCKFQKA
  KVVYEKLWNGSYFNYDNSGQSASASIQADQLAGQCGSQLIIQLICRYTGACGLMPIVDQDKAQSALEKVYNYNVLKVKNGKLGAVNGMLPDGTVDMTTLQ
  SREIWSGVTYAVAATMIQEDMLDMAFHTAGGVHAAAWSEEGLGYSFQTPEAWTTTGEFRSLAYMRPLAIWAMQ
Full Sequence
Protein Sequence     Length: 1066     Download
MGDKENGFAE RDDQHSESSI DKVDPGKPAY LTWQRKVNST GKAVVEFNLT LKEVIHMAPI    60
GIRLWRHQRE ETAKGREIMI DPFTKRARSS SHGVPLGGMG GGSIGRSLKG EFQRWQLLPK    120
TCEEDPVLAD QFSVFVSRTN GEKYSSVLCP RNPDVKGNNA SGIGSWDWNL KGDKSTYHAL    180
FPRAWSIYEG EPDPALKIVC RQISPIIPHN YKESSFPVSV FTFTLYNSGS TAANTTLLFT    240
WANSIGGLSE FSGQHVNSRA KVKDGVHSVL LHHKTATGKS PVTFAIAAEQ TDGIHVSECP    300
CFVISGDSKG ISAKDMWNEI KQGYNSFDTA IDNIAPSNRQ CVLNMATIDC LHGSFDGLNS    360
AETSLPSEQG SSIGAAVAAS VTVPPDGVRT VTFSLAWDSP EIIMGGKTYY RRYTKFFGTH    420
GNAAANIAHD AILEHHNWES QIEAWQRPIL EDKRLPEWYP VTLFNELYYL NSGGTIWTDG    480
SPPVHSLVSI GGRKFSLDKS SLGVKNIIDA PQQNDTAVDI LGRMTTILEQ IHMPVASNSA    540
FGPNLLQEGE ENIGQFLYLE GVEYHMWNTY DVHFYSSFAL VMLFPKLELS IQRDFAAAVM    600
MHDPSKMSVL CDGKLVQRKV LGAVPHDIGI HDPWFEVNAY NVYNTDRWKD LNPKFVLQIY    660
RDVVATGDKK FAEAVWPSVY VAMAYMEQFD RDGDGMIENE GFPDQTYDTW SVTGVSAYCG    720
GLWLAALQAA SALAREVGDK GSEDYFWCKF QKAKVVYEKL WNGSYFNYDN SGQSASASIQ    780
ADQLAGQCGS QLIIQLICRY TGACGLMPIV DQDKAQSALE KVYNYNVLKV KNGKLGAVNG    840
MLPDGTVDMT TLQSREIWSG VTYAVAATMI QEDMLDMAFH TAGGVHAAAW SEEGLGYSFQ    900
TPEAWTTTGE FRSLAYMRPL AIWAMQWALS RPNKVLNRET RAEVDQVSLL RDEAGFARVA    960
QLLKLPPEEA ASRSILQFSS EVDIRLLPQG LGHIYPDHIS RGALNGHPPR TCRNPQVEPL    1020
KIGNLQKDMI IEDPFQPLKA AVKESFRCQR MINTPKKSDA GNMRP*                   1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43544.0e-939147991+
COG4354COG43548.0e-1116125093+
pfam12215GBA2_N7.0e-43111438337+
COG4354COG43544.0e-65553929396+
pfam04685DUF6084.0e-158554927379+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)