y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna03056.1-v1.0-hybrid
FamilyGT57
Protein PropertiesLength: 869 Molecular Weight: 97019.7 Isoelectric Point: 9.3308
ChromosomeChromosome/Scaffold: 3 Start: 10134253 End: 10145274
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57315150
  ATCLKLLLIPAYRSTDFEVHRHWLAITNSLPLSQWYSDETSLWTLDYPPFFAYFERLLSLFANLIDPQIVHLHNGLNYSSDTVVYFQRVSVCVSDLCLLF
  GVYRLTRRLDHVRRRVMWVLVVWSPMLLIVDHLHFQYNGLLLGVLLVSVSYLEEGRDLMGGFVFAVLLCFKHLFAVAAPVYFVYLLRHYCWKGLVKGFGR
  LLVMGSVVVAVFTVAYGPFVYHGQMKQVIHRMFPFGRGLCHAYWAPNFWVFYILLDKVIAFLLGRLGFNIQAPAASFTGGLVGDSSPFAVLPQITPAITF
  IMVLLALSPCLIKAWRDPRPVMITRWVAYAYTCGFLFGWHVHEKASLQFVIPLAIVAVQDLDTARHYFFLSIVSCYSLFPLLYESQEYPIKVLLLLLHSM
  LMWLGFSAQFTKDKTLEMAPSGKRKDNHIGSNRSTAAAQKGGFVIGWEIWSYLVGLVLVEIWGQFLHPMFLGDKLPFLPLMLIST
Full Sequence
Protein Sequence     Length: 869     Download
MEPQTTKKIL KNPSKPNNPK LSELWWFFAA ATCLKLLLIP AYRSTDFEVH RHWLAITNSL    60
PLSQWYSDET SLWTLDYPPF FAYFERLLSL FANLIDPQIV HLHNGLNYSS DTVVYFQRVS    120
VCVSDLCLLF GVYRLTRRLD HVRRRVMWVL VVWSPMLLIV DHLHFQYNGL LLGVLLVSVS    180
YLEEGRDLMG GFVFAVLLCF KHLFAVAAPV YFVYLLRHYC WKGLVKGFGR LLVMGSVVVA    240
VFTVAYGPFV YHGQMKQVIH RMFPFGRGLC HAYWAPNFWV FYILLDKVIA FLLGRLGFNI    300
QAPAASFTGG LVGDSSPFAV LPQITPAITF IMVLLALSPC LIKAWRDPRP VMITRWVAYA    360
YTCGFLFGWH VHEKASLQFV IPLAIVAVQD LDTARHYFFL SIVSCYSLFP LLYESQEYPI    420
KVLLLLLHSM LMWLGFSAQF TKDKTLEMAP SGKRKDNHIG SNRSTAAAQK GGFVIGWEIW    480
SYLVGLVLVE IWGQFLHPMF LGDKLPFLPL MLISTAYERV GKSRAVIFDY LMERLSKNLS    540
AGKQKFLVLQ ETLIKTSGDI CKSEGSAEDS AHVLCKRPTA SNVLSSLNLG NSLLPKFTLE    600
TVDAGTFFAS ESLDKLRKPK IRKKAMWKRA ANWGWKLNVD DSFLAPILLL VDILEPERPP    660
LSATMLRRAT ALLTRPASSS LRAARAFSTE VAEAGDAPAN PAFNEAWKKV VPHIEPPKTP    720
LSFMKPRPAV PSSIPTKLTV NFVLPYASEL SAKEVDMVII PASTGQMGVL PGHVATIAEL    780
KPGILSVHEG NDVTKYFVSS GFAFIHANSY ADIIAVEAVP IDRVDASLVQ KGLAEFTQKL    840
NSASTDLEKA EAQIGVDVHS ALNAALTG*                                      900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK00571atpC2.0e-17738854118+
pfam02823ATP-synt_DE_N2.0e-1973881882+
COG0355AtpC5.0e-20738858123+
cd12152F1-ATPase_delta2.0e-31738861125+
pfam03155Alg6_Alg83.0e-10030515502+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0015986ATP synthesis coupled proton transport
GO:0016758transferase activity, transferring hexosyl groups
GO:0045261proton-transporting ATP synthase complex, catalytic core F(1)
GO:0046933proton-transporting ATP synthase activity, rotational mechanism
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4b2q_h2e-197388664131V Chain V, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average
PDB4b2q_H2e-197388664131V Chain V, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average
PDB3zry_H2e-197298661137V Chain V, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average
PDB3zia_R2e-197298661137J Chain J, The Structure Of F1-atpase From Saccharomyces Cerevisiae Inhibited By Its Regulatory Protein If1
PDB3zia_H2e-197298661137J Chain J, The Structure Of F1-atpase From Saccharomyces Cerevisiae Inhibited By Its Regulatory Protein If1
Transmembrane Domains
StartEnd
2143
114133
146165
193215
228250
265284
291313
323345
396413
418440
473495
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00352.1
Arabidopsis lyrata903892
Arabidopsis thalianaAT2G44660.1
Brachypodium distachyonBradi3g52040.1
Brassica rapaBra004854
Carica papayaevm.model.supercontig_50.144
Capsella rubellaCarubv10023047m
Chlamydomonas reinhardtiiCre09.g414250.t1.3.19.125Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.19.125
Citrus clementinaCiclev10014906m
Citrus sinensisorange1.1g019776morange1.1g026008morange1.1g009885m
Cucumis sativusCucsa.362250.1
Eucalyptus grandisEucgr.E01703.1
Glycine maxGlyma08g10420.1Glyma05g27431.2Glyma05g27431.1
Gossypium raimondiiGorai.003G062300.1
Linum usitatissimumLus10043344Lus10019495
Malus domesticaMDP0000238047
Manihot esculentacassava4.1_005358m
Medicago truncatulaMedtr5g077540.1
Mimulus guttatusmgv1a004526m
Oryza sativaLOC_Os02g46320.1
Panicum virgatumPavirv00056060mPavirv00065643m
Physcomitrella patensPp1s34_140V6.1
Phaseolus vulgarisPhvul.007G221000.2Phvul.007G221000.1
Picea abiesMA_10429975g0010MA_7890741g0010
Populus trichocarpaPotri.014G053200.1
Prunus persicappa016151mppa004246m
Ricinus communis29634.m002078.26.16329634.m002078.26.16329634.m002078.164.48529634.m002078.164.485
Setaria italicaSi016919m
Selaginella moellendorffii45405.175.35645405.175.356
Sorghum bicolorSb04g031440.1
Thellungiella halophilaThhalv10001410m
Vitis viniferaGSVIVT01018341001
Volvox carteriVocar20011939m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny