y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna03581.1-v1.0-hybrid
FamilyCBM45
Protein PropertiesLength: 1544 Molecular Weight: 171476 Isoelectric Point: 6.193
ChromosomeChromosome/Scaffold: 4 Start: 24319506 End: 24335624
DescriptionPyruvate phosphate dikinase, PEP/pyruvate binding domain
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM452533282.5e-24
  LHWGGIQDRKENWVLPSRHPDGTTVYKKKALRTPFAKSGPNSSLKIEIDDPAIQAIEFLIVDESQNRWFKNNGGNF
Full Sequence
Protein Sequence     Length: 1544     Download
MASFSCYHQI SEYNGGGGFR AGNHDDGGSV EDSPYWIHAL RWVRSWGDPL YVGSFKKAKN    60
KLGKPNMSSF EFMASLVLLL SVLVRPIHIK KIEQDLVLSI NSASCAATDT VSSAPRKLPV    120
EEIKVLEEEE EDLSDCSTVT VDSSKINPSG IPANTLLRPK CVHQVPAQPR KSSLSKKFCG    180
NSLQKPKLAM GSRRPVTFVP CAVLTTDQRS DQQLASKYNL DGNIELQVYV DASSPGSTKV    240
DIHVSNSGDS LVLHWGGIQD RKENWVLPSR HPDGTTVYKK KALRTPFAKS GPNSSLKIEI    300
DDPAIQAIEF LIVDESQNRW FKNNGGNFHV KLPLKEMSIS NVSVPEDLVQ IQAYLRWERK    360
GKQMYTPEQE KASELYSRIL QIPNCHCFYI SNYNCVEYEA ARTELLEEVA RGASIQELQA    420
RLTKKSDSGN SHEQSQAGNK EVSKAAKKHE SKQVYRTGRI NRKQRDLMKI LNKHTTKPVD    480
EAKLANEESA KPKALKAVEL FAKEKEEQDG ASTLNKQIYK LGDKDLLVLV TKVADKIRVH    540
LATDIKEPVN LHWALSVNRA GEWLEPPPNV LPQGSVSLNG AVETQFVSSS VDSTYEIQSL    600
EIETQEKSFK GMPFVLCSSG NWIKNQGSDF YADFGVAVKK VQKDAGDGKG TAKALLDNIA    660
DLETDLMSQA KDAGALGLAG ILVWMRFMAT RQLIWNKNYN VKPREISKAQ DRLTDLLQSI    720
YISYPQHREL LRMILSTVGR GGEGDVGQRI RDEILVIQRN CDCKGGMMEE WHQKLHNNTS    780
PDDVVICQAL IDYIKSDFDI GVYWKTLNDN GITKERLLSY DRAIHNEPRF RADQKDRLLH    840
DLGNYLRTLK AVHSGADLES AITNCLGYSA KGQGFMVGVQ INPVSGLPSE VPGLLQFVME    900
HVEDRNVEVL VEGLLEARQE IWPLLSKPND RLKDLLFLDI ALDSTVRTAI ERGYEELNNA    960
GPEKIMYFIS MVLENLALSS DDNEDLLYCL KGWNQALNML KNNADHWALF AKSILDRTRL    1020
ALANKAELYH SILQPSAEYL GSKLGVDKLA LSIFTEEVIR AGSAASLSTL VNRLDPVLRK    1080
TANLGSWQVI SPVEVVGYVV VVDELLTVQN KVYDKPTILV ARSVRGEEEI PDGTVAVLTP    1140
DMPDVLSHVS VRARNSKVCF ATCFDSNILA DLQACEGKLL RVKPTSADVV YSEVNESELG    1200
DASSTNLNED TPALTLVKKQ FTGRYAISSD EFTSEMVGAK SRNISYIKGK LPSWVGIPTS    1260
VALPFGVFEK VLSEDSNKAV ADKIETLKKK LKEGDFGSLG EIRETVLQLT APPPLVQELK    1320
SKMQSSGMPW PGDEGEQRWE QAWLSIKKVW ASKWNERAYF STRKVKLDHD YLCMAVLVQE    1380
IINADYAFVI HTTNPSSGDS SEIYAEVVKG LGETLVGAYP GRALSFISKK NDLDSPQLLG    1440
YPSKPIGLFI RRSIIFRSDS NGEDLEGYAG AGLYDSVPMD KEEEVVLDYS SDPLVTDGNF    1500
QKKILSSIAH AGNAIEELYG LPQDIEGVIR DGKLYVVQTR PQM*                     1560
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0574PpsA9.0e-1213381541207+
PRK06241PRK062416.0e-1213451541203+
TIGR01418PEP_synth4.0e-1412351542345+
PRK06464PRK064644.0e-1413461541209+
pfam01326PPDK_N2.0e-3012331542335+
Gene Ontology
GO TermDescription
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016310phosphorylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2ols_A0.00313451542157336A Chain A, The Crystal Structure Of The Phosphoenolpyruvate Synthase From Neisseria Meningitidis
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00059.2.125.200Aquca_002_00059.2.125.200Aquca_002_00059.1.125.200Aquca_002_00059.1.125.200Aquca_010_00076.4
Aquca_010_00076.3Aquca_010_00076.2Aquca_010_00076.1Aquca_002_00499.4.322.398Aquca_002_00499.4.322.398
Aquca_002_00499.3.322.398Aquca_002_00499.3.322.398Aquca_002_00499.2.322.398Aquca_002_00499.2.322.398Aquca_002_00499.1.322.398
Aquca_002_00499.1.322.398Aquca_002_00059.3Aquca_002_00059.2.379.458Aquca_002_00059.2.379.458Aquca_002_00059.1.379.458
Aquca_002_00059.1.379.458Aquca_002_00499.4.126.212Aquca_002_00499.4.126.212Aquca_002_00499.3.126.212Aquca_002_00499.3.126.212
Aquca_002_00499.2.126.212Aquca_002_00499.2.126.212Aquca_002_00499.1.126.212Aquca_002_00499.1.126.212
Arabidopsis lyrata888368.117.192888368.117.192339218.127.210888368.391.469888368.391.469
492401
Arabidopsis thalianaAT1G10760.1.120.195AT1G10760.1.120.195AT1G69830.1.305.381AT1G69830.1.305.381AT1G69830.1.126.209
AT1G69830.1.126.209AT1G10760.1.394.472AT1G10760.1.394.472AT4G24450.1
Brachypodium distachyonBradi1g41907.2.109.184Bradi1g41907.2.109.184Bradi1g41907.1.109.184Bradi1g41907.1.109.184Bradi3g11270.1
Bradi2g48150.1.119.204Bradi2g48150.1.119.204Bradi1g41907.2.447.524Bradi1g41907.2.447.524Bradi1g41907.1.447.524
Bradi1g41907.1.447.524Bradi2g48150.1.299.375Bradi2g48150.1.299.375
Brassica rapaBra031749Bra018423.116.191Bra018423.116.191Bra016262.314.390Bra016262.314.390
Bra016262.127.210Bra016262.127.210Bra018423.389.467Bra018423.389.467Bra013803
Carica papayaevm.model.supercontig_69.90evm.model.supercontig_5.271.119.202
Capsella rubellaCarubv10008131mCarubv10019759m.318.394Carubv10019759m.318.394Carubv10019759m.133.214Carubv10019759m.133.214
Carubv10006877m
Citrus clementinaCiclev10030521mCiclev10030520mCiclev10030501mCiclev10030500mCiclev10030499m
Ciclev10030780m.171.247Ciclev10030661m.319.395Ciclev10030661m.319.395Ciclev10017434mCiclev10030661m.128.211
Ciclev10030661m.128.211
Citrus sinensisorange1.1g006158m.75.151orange1.1g004353m.317.393orange1.1g004353m.317.393orange1.1g003698m.219.295orange1.1g003698m.219.295
orange1.1g003613m.317.393orange1.1g003613m.317.393orange1.1g003004m.317.393orange1.1g003004m.317.393orange1.1g002611m.317.393
orange1.1g002611m.317.393orange1.1g002585m.317.393orange1.1g002585m.317.393orange1.1g001903morange1.1g001677m
orange1.1g001333morange1.1g001268morange1.1g001019morange1.1g004353m.126.209orange1.1g004353m.126.209
orange1.1g003698m.28.111orange1.1g003698m.28.111orange1.1g003613m.126.209orange1.1g003613m.126.209orange1.1g003004m.126.209
orange1.1g003004m.126.209orange1.1g002611m.126.209orange1.1g002611m.126.209orange1.1g002585m.126.209orange1.1g002585m.126.209
Cucumis sativusCucsa.286300.3Cucsa.286300.2Cucsa.286300.1Cucsa.285330.2.172.248Cucsa.285330.1.312.388
Cucsa.285330.1.312.388Cucsa.285330.1.120.205Cucsa.285330.1.120.205
Eucalyptus grandisEucgr.H02531.2.128.203Eucgr.H02531.2.128.203Eucgr.H02531.1.128.203Eucgr.H02531.1.128.203Eucgr.G02543.2.332.409
Eucgr.G02543.2.332.409Eucgr.G02543.1.332.409Eucgr.G02543.1.332.409Eucgr.H02531.2.459.539Eucgr.H02531.2.459.539
Eucgr.H02531.1.459.539Eucgr.H02531.1.459.539Eucgr.G02543.2.138.224Eucgr.G02543.2.138.224Eucgr.G02543.1.138.224
Eucgr.G02543.1.138.224
Glycine maxGlyma08g39110.2.123.198Glyma08g39110.2.123.198Glyma08g39110.1.123.198Glyma08g39110.1.123.198Glyma18g20600.2.123.198
Glyma18g20600.2.123.198Glyma02g02450.1.313.389Glyma02g02450.1.313.389Glyma08g39110.2.452.531Glyma08g39110.2.452.531
Glyma08g39110.1.452.531Glyma08g39110.1.452.531Glyma18g20600.2.452.531Glyma18g20600.2.452.531Glyma08g40810.1.133.219
Glyma08g40810.1.133.219Glyma08g40810.1.327.403Glyma08g40810.1.327.403Glyma04g10375.2Glyma04g10375.1
Glyma02g02450.1.120.206Glyma02g02450.1.120.206
Gossypium raimondiiGorai.002G186200.7.135.210Gorai.002G186200.7.135.210Gorai.002G186200.6.121.196Gorai.002G186200.6.121.196Gorai.002G186200.5.135.210
Gorai.002G186200.5.135.210Gorai.002G186200.4.135.210Gorai.002G186200.4.135.210Gorai.002G186200.3.135.210Gorai.002G186200.3.135.210
Gorai.002G186200.2.135.210Gorai.002G186200.2.135.210Gorai.002G186200.1.136.211Gorai.002G186200.1.136.211Gorai.008G160400.2
Gorai.008G160400.1Gorai.002G186200.8Gorai.002G186200.7.465.544Gorai.002G186200.7.465.544Gorai.002G186200.6.451.530
Gorai.002G186200.6.451.530Gorai.002G186200.5.465.544Gorai.002G186200.5.465.544Gorai.002G186200.4.465.544Gorai.002G186200.4.465.544
Gorai.002G186200.3.465.544Gorai.002G186200.3.465.544Gorai.002G186200.2.465.544Gorai.002G186200.2.465.544Gorai.002G186200.1.466.545
Gorai.002G186200.1.466.545Gorai.008G182600.7Gorai.008G182600.6.125.208Gorai.008G182600.5.125.208Gorai.008G182600.4.125.208
Gorai.008G182600.3.123.206Gorai.008G182600.2.125.208Gorai.008G182600.1.125.208
Linum usitatissimumLus10013044.135.210Lus10013044.135.210Lus10029118.135.210Lus10029118.135.210Lus10036717.126.209
Lus10036717.126.209Lus10030793.133.216Lus10030793.133.216Lus10013270.136.219Lus10013270.136.219
Lus10037211.126.209Lus10037211.126.209Lus10030793.315.391Lus10030793.315.391Lus10013270.318.394
Lus10013270.318.394Lus10037211.305.381Lus10037211.305.381Lus10036717.305.381Lus10036717.305.381
Lus10029118.445.523Lus10029118.445.523Lus10013044.463.541Lus10013044.463.541Lus10032829
Malus domesticaMDP0000252405.192.267MDP0000252405.192.267MDP0000951961.54.127MDP0000951961.54.127MDP0000951961.323.402
MDP0000951961.323.402MDP0000252405.478.557MDP0000252405.478.557
Manihot esculentacassava4.1_000266m.133.208cassava4.1_000266m.133.208cassava4.1_004613m.310.386cassava4.1_004613m.310.386cassava4.1_000266m.404.482
cassava4.1_000266m.404.482cassava4.1_004613m.121.204cassava4.1_004613m.121.204cassava4.1_001555m.120.203cassava4.1_001362m.120.203
Mimulus guttatusmgv1a000186mmgv1a000185mmgv1a001104m.306.382mgv1a001104m.306.382mgv1a001104m.125.211
mgv1a001104m.125.211
Oryza sativaLOC_Os01g51754.4LOC_Os01g51754.3
Panicum virgatumPavirv00036852m.113.188Pavirv00036852m.113.188Pavirv00030888m.120.203Pavirv00030888m.120.203Pavirv00061832m.120.203
Pavirv00061832m.120.203Pavirv00036852m.456.533Pavirv00036852m.456.533Pavirv00061832m.304.382Pavirv00061832m.304.382
Pavirv00030888m.304.382Pavirv00030888m.304.382
Phaseolus vulgarisPhvul.003G062900.1.120.195Phvul.003G062900.1.120.195Phvul.002G065700.1.313.389Phvul.002G065700.1.313.389Phvul.003G062900.1.449.528
Phvul.003G062900.1.449.528Phvul.003G069200.1.132.218Phvul.003G069200.1.132.218Phvul.003G069200.1.326.402Phvul.003G069200.1.326.402
Phvul.002G065700.1.119.205Phvul.002G065700.1.119.205
Picea abiesMA_50250g0010MA_108710g0010MA_72129g0020
Populus trichocarpaPotri.010G044100.4.130.205Potri.010G044100.4.130.205Potri.010G044100.3Potri.010G044100.2Potri.010G044100.1
Potri.008G188200.2Potri.008G188200.1Potri.010G092900.9.140.223Potri.010G092900.9.140.223Potri.010G092900.8.140.223
Potri.010G092900.8.140.223Potri.010G092900.6.140.223Potri.010G092900.6.140.223Potri.010G092900.5.140.223Potri.010G092900.5.140.223
Potri.010G092900.4.140.223Potri.010G092900.4.140.223Potri.010G092900.3.140.223Potri.010G092900.3.140.223Potri.010G092900.2.140.223
Potri.010G092900.2.140.223Potri.010G092900.1.140.223Potri.010G092900.1.140.223Potri.010G092900.9.331.407Potri.010G092900.9.331.407
Potri.010G092900.8.331.407Potri.010G092900.8.331.407Potri.010G092900.6.331.407Potri.010G092900.6.331.407Potri.010G092900.5.320.396
Potri.010G092900.5.320.396Potri.010G092900.4.316.392Potri.010G092900.4.316.392Potri.010G092900.3.331.407Potri.010G092900.3.331.407
Potri.010G092900.2.327.403Potri.010G092900.2.327.403Potri.010G092900.1.331.407Potri.010G092900.1.331.407Potri.010G044100.4.469.548
Potri.010G044100.4.469.548
Prunus persicappa000209m.127.202ppa000209m.127.202ppa001575m.213.289ppa000209m.462.540ppa000209m.462.540
Ricinus communis27504.m000617.131.20627504.m000617.131.20629736.m002033.124.20729736.m002033.124.20729736.m002033.313.389
29736.m002033.313.38927504.m000617.462.54127504.m000617.462.541
Setaria italicaSi005690m.113.188Si005690m.113.188Si000308m.120.203Si000308m.120.203Si000258m.120.203
Si000258m.120.203Si005690m.456.533Si005690m.456.533Si000308m.304.382Si000308m.304.382
Si000258m.304.382Si000258m.304.382
Sorghum bicolorSb10g017820.1.117.192Sb10g017820.1.117.192Sb03g032830.1.58.143Sb03g032830.1.58.143Sb10g017820.1.460.537
Sb10g017820.1.460.537Sb03g032830.1.241.319Sb03g032830.1.241.319
Thellungiella halophilaThhalv10006578mThhalv10006565mThhalv10018099m.133.216Thhalv10018099m.133.216Thhalv10018099m.318.394
Thhalv10018099m.318.394Thhalv10024230m
Vitis viniferaGSVIVT01013806001GSVIVT01020069001.305.381GSVIVT01020069001.305.381GSVIVT01020069001.117.203GSVIVT01020069001.117.203
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)