y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna03872.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 603 Molecular Weight: 66979.6 Isoelectric Point: 5.2097
ChromosomeChromosome/Scaffold: 4 Start: 25667326 End: 25671611
DescriptionDi-glucose binding protein with Leucine-rich repeat domain
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572113571.8e-22
  NDTDQFSRSWQSDAQFRTIDSESPARVISTTNSISHAGDAPNFFPMRLYQSAVTADGKKNLEYDLTVDAKLDYLLWFHFAEIDPKMNKVGDRVFDIFIND
  KNVTRIDIYKEVGSFRAYTWHYTVKNLSSTQLNVQLKGVAGTPLISG
Full Sequence
Protein Sequence     Length: 603     Download
MSLLFFLLPL LLLFVSAHSY SYYGLSYNID CGSATNSTDG FNTTWLSDRF YTGGSSYYVS    60
EPLQFRHPQE KTLRFFPPSS GKKNCYVVPD LPSGRYYVRT FTVYDNYDGK SHPPSFDASV    120
EGTLVFSWRS PWPEDLTRTG AYSDLFVFVT DGEADICFYS IATDSPVVGS LQIVQVDPAS    180
YDGGFDGRKY ILVNYGRLSC GSGQWGPGFS NDTDQFSRSW QSDAQFRTID SESPARVIST    240
TNSISHAGDA PNFFPMRLYQ SAVTADGKKN LEYDLTVDAK LDYLLWFHFA EIDPKMNKVG    300
DRVFDIFIND KNVTRIDIYK EVGSFRAYTW HYTVKNLSST QLNVQLKGVA GTPLISGLEN    360
YAMVPADVAT LPEQVVAMRA LKESLRVPDR MGWNGDPCAP TNWDAWEGVT CHLNKNETAL    420
VISRIDLGSQ GLKGFISDQI NLLSDLLSLD LSDNQLTGSI PESLTSSNLQ LVLLNDNLLD    480
GRVPEQLYSI GVHGGAIDLY GNKGLCGVPS LPDCPLFWEN GGLSTKGKIA IGISCGVILC    540
LMLLVVYIIY VRRRRNDYDF GFPHDLIPLG AKTNRYHRQK SIAVLEMESQ HAKADLQPLQ    600
GK*                                                                  660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin8.0e-526159148+
pfam11721Malectin2.0e-13197358176+
pfam12819Malectin_like1.0e-5829363353+
PLN03150PLN031505.0e-10029544551+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hq1_A0.001374484324427A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
PDB3rj0_A0.002425514658745A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
Transmembrane Domains
StartEnd
529551
Signal Peptide
Cleavage Site
19
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)