y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna03924.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 245 Molecular Weight: 27584.2 Isoelectric Point: 9.0196
ChromosomeChromosome/Scaffold: 7 Start: 9920635 End: 9921369
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8112290
  SFFAGVSGDGFWARDITFENTAGPQKHQAVALRVSSDLAVFYRCSIKGYQDSLYAHSLRQFYRDSHIYGTIDFIFGDASVVLQNCDILVRRPLGHQSNMI
  TAQGRDNPAENTGNVIHGCRVRPAREFEGVKGSFKTYLDRPWHKYSRTVFLKTDLDGLVDPKGWTEWRGSFAISTLYYGEYMNVGQGASTDKRVRWPSFH
  VLNSPREVSPYSISHFIQG
Full Sequence
Protein Sequence     Length: 245     Download
MTLKQSLVML SFFAGVSGDG FWARDITFEN TAGPQKHQAV ALRVSSDLAV FYRCSIKGYQ    60
DSLYAHSLRQ FYRDSHIYGT IDFIFGDASV VLQNCDILVR RPLGHQSNMI TAQGRDNPAE    120
NTGNVIHGCR VRPAREFEGV KGSFKTYLDR PWHKYSRTVF LKTDLDGLVD PKGWTEWRGS    180
FAISTLYYGE YMNVGQGAST DKRVRWPSFH VLNSPREVSP YSISHFIQGE SWILGTGVPV    240
WLGI*                                                                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02484PLN024849.0e-10411244234+
PLN02713PLN027133.0e-10713239227+
PLN02301PLN023015.0e-11416238223+
pfam01095Pectinesterase8.0e-13215230216+
PLN02916PLN029162.0e-14515244230+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A01823889309B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A01824493319A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_B1e-1735205126318A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_A1e-1735205126318A Chain A, Pectin Methylesterase From Carrot
PDB2ntp_B1e-1735205126318A Chain A, Pectin Methylesterase From Carrot
Signal Peptide
Cleavage Site
18
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata333607.373.507333607.373.507
Citrus sinensisorange1.1g048471m
Cucumis sativusCucsa.250450.1
Gossypium raimondiiGorai.008G143800.2.336.504Gorai.008G143800.2.336.504
Linum usitatissimumLus10028536
Malus domesticaMDP0000517601.106.280MDP0000517601.106.280MDP0000289583MDP0000258316
Medicago truncatulaMedtr8g104620.1Medtr8g104580.1.313.484Medtr8g104580.1.313.484
Panicum virgatumPavirv00003946m
Picea abiesMA_10332149g0010MA_648837g0010MA_86577g0010.275.448MA_86577g0010.275.448MA_26888g0010.97.276
MA_26888g0010.97.276
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny