y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna03925.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 266 Molecular Weight: 28440.3 Isoelectric Point: 7.1277
ChromosomeChromosome/Scaffold: 7 Start: 9921516 End: 9922454
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81882594.4e-22
  FVVAKDGSGTHTTINHAVAALARMGDRRPPRAIIYVKSGVYNEKVEIGGHMKNVMLVGDGMDRTVITVAAVS
Full Sequence
Protein Sequence     Length: 266     Download
MSTSVTTFLL LLLSITMASS TSCFQDPKPV QLALDGVLQA TNVVRTSMDR LHVLASSESD    60
SSGSDVALMD CERLYDESVP RLTELISGEG NYTEEDARTW LSGVLANHRS CWDSLEKKGV    120
VKNTSGAQQY RAVAQNLTVV LGEALALYGK STMTTDEAMK VRHGQTSNAK PYGGLLASWS    180
PARSRADFVV AKDGSGTHTT INHAVAALAR MGDRRPPRAI IYVKSGVYNE KVEIGGHMKN    240
VMLVGDGMDR TVITVAAVSS MVTPP*                                         300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01095Pectinesterase5.0e-2318725468+
PLN02170PLN021701.0e-2670254205+
PLN02314PLN023146.0e-2767254215+
PLN02301PLN023011.0e-3167254202+
PLN02916PLN029164.0e-7623254245+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A0.0000000002186254368B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A0.000000031892561074A Chain A, Pectin Methylesterase From Carrot
Signal Peptide
Cleavage Site
23
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00168.3Aquca_020_00601.2.274.356Aquca_020_00601.2.274.356Aquca_020_00601.4
Citrus sinensisorange1.1g017225morange1.1g018173m
Eucalyptus grandisEucgr.E01465.1
Fragaria vescamrna03928.1-v1.0-hybrid
Malus domesticaMDP0000146296MDP0000460020MDP0000128213MDP0000206593MDP0000163228
MDP0000712623MDP0000517601.19.102MDP0000672480MDP0000222620MDP0000162904.274.358
MDP0000162904.274.358MDP0000517601.19.102
Medicago truncatulaMedtr8g104580.1.221.312Medtr8g104580.1.221.312Medtr8g104630.1Medtr8g023310.2
Oryza sativaLOC_Os01g21034.2LOC_Os01g21034.3
Panicum virgatumPavirv00054581mPavirv00058605m
Physcomitrella patensPp1s29_318V6.1.198.287Pp1s29_318V6.1.198.287
Picea abiesMA_2409806g0010MA_7418191g0010
Populus trichocarpaPotri.002G202500.3
Prunus persicappa020079m
Ricinus communis29739.m003671.273.36129739.m003671.273.361
Setaria italicaSi004722m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny