y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna03928.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 339 Molecular Weight: 37142.5 Isoelectric Point: 7.5343
ChromosomeChromosome/Scaffold: 7 Start: 9937084 End: 9939357
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81322219.8e-25
  FVVAKDGSGTHTTINHAVAALARMGDKRPPRAIIYVKSGVYNEKVEIGGHMKNVMLVGDGMDRTVIIGSRSVVDGDTTLTSATFGREQHG
Full Sequence
Protein Sequence     Length: 339     Download
MDRLHVLASS ESDPPGCDVA LMDCERLYDE SVPRLTELIS GEGNYTGEDA WTWLSGVLAN    60
HRSCWAGLEE KGVVKNTSAA QQYRAVAQNL TVVLGEALAL YGKKVLHRQN SNAKPNGGLL    120
ASWNPARSRA DFVVAKDGSG THTTINHAVA ALARMGDKRP PRAIIYVKSG VYNEKVEIGG    180
HMKNVMLVGD GMDRTVIIGS RSVVDGDTTL TSATFGREQH GYIWPLPMRC FSLVEAEFSD    240
GVKKIGIRME IIRIRIIRIG SGLGLKPTRS EYAQPYEEDQ TSDLLLPGVP LLASRQVVDF    300
ISKQRVSYGL LRKLKMKLLS VNAVLDEAAF CEFVDFDF*                           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01095Pectinesterase8.0e-3213122393+
PLN02170PLN021701.0e-3323223220+
PLN02314PLN023142.0e-349223245+
PLN02301PLN023017.0e-4020223218+
PLN02916PLN029164.0e-8019222225+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A2e-17130223393B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A0.0000000000006131223897A Chain A, Pectin Methylesterase From Carrot
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00168.3Aquca_020_00601.2.274.356Aquca_020_00601.2.274.356Aquca_020_00601.4
Citrus sinensisorange1.1g017225morange1.1g018173m
Eucalyptus grandisEucgr.E01465.1
Fragaria vescamrna03925.1-v1.0-hybrid
Malus domesticaMDP0000146296MDP0000460020MDP0000128213MDP0000206593MDP0000163228
MDP0000712623MDP0000517601.19.102MDP0000672480MDP0000222620MDP0000162904.274.358
MDP0000162904.274.358MDP0000517601.19.102
Medicago truncatulaMedtr8g104580.1.221.312Medtr8g104580.1.221.312Medtr8g104630.1Medtr8g023310.2
Oryza sativaLOC_Os01g21034.2LOC_Os01g21034.3
Panicum virgatumPavirv00054581mPavirv00058605m
Physcomitrella patensPp1s29_318V6.1.198.287Pp1s29_318V6.1.198.287
Picea abiesMA_2409806g0010MA_7418191g0010
Populus trichocarpaPotri.002G202500.3
Prunus persicappa020079m
Ricinus communis29739.m003671.273.36129739.m003671.273.361
Setaria italicaSi004722m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny