y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04286.1-v1.0-hybrid
FamilyGH13
Protein PropertiesLength: 1389 Molecular Weight: 155689 Isoelectric Point: 5.2595
ChromosomeChromosome/Scaffold: 6 Start: 32984988 End: 32996843
DescriptionTransducin/WD40 repeat-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13102013041.8e-38
  LSKIGVTSVWFPPPTESVAPQGYMPSDLYNLNSAYGTEEELKYCIAEMHAHDLLALGDVVLNHRCAHKQSPNGVWNIFGGKLAWGPEAIVCDDPNFEGRG
  NPSSGDIFHAAPNIDHSKDFVRNDIKEWLNWLRSDIGFDGWRLDFVRGFSGSYVKEYIEASTPAFAIGEYWDSLAYENGNLCYNQDAHRQRIVNWINATG
  GSSSAFDVTTKGILHSALHNQYWRLIDPQGKPTGVMGWWPSRAVTFLENHDTGSTQGHWPFPREKLTQGYAYILTHPGTPTIFYD
Full Sequence
Protein Sequence     Length: 1389     Download
MEIDEGTEDR QVQVRFVTKL QDIPFKVPNT TIPASYSRLD LSKVVNALIQ TENPEWESEP    60
FDFLINGVLV RMSLGQFLLA KGISAEKTLE IEYIRAIVPR KEEEPCLHND WVSAVDGSSP    120
RFILTGCYDG LGRVWTASGT CTHILQGHSE PVTSVSVISA EGGESCRVAT ASKDRTLRLW    180
KFNTEEPTNN ALRTTAYKIL RGHGAAVQSV AAHTSGEMVC SGSWDSTIKL WQTDEPDIEV    240
DVSVKKRKKA EAVSSLVGHT QCVSSVKWPQ RDIIYSASWD HSIRRWDIES GKDILNIPCS    300
KALNCLDIGG EGSALVAGGG SDPILRIWDP RKPGTSAPVG QFSSHTSWIT ACKWHESSWF    360
HVLSASYDGK VMLWDMRTTW PLFVIDSHKD SKVLCVDWWK GDSVVSGGAD TKLCISSGVS    420
ALGLFPTSPC RIQVDIANMT ALYALGRGGL LSSELPLIEK RNYSSQNIGQ VNQEQAFFQA    480
WYADDSGVTD VVDNSDGFSS GRNDMLDVQE DKLMAVKRAL SEAQARQDAI EKERDQLLEE    540
LACAEAKQQE YVAAILHDKD MAVSELEAAK SLFDQKLQES VQEKFRLQDK LVLMKQDAVE    600
LAVQVERLAE IAFQQATSHI LEDSQLRVAA AETTAAEACY QIEKQIKDMT EGTILSIVEQ    660
SKNAIEKALD VAEKAGDHAT KAASAFSDSM SPLDELASVQ SKNIMLQGTV NDLESQLLLT    720
RSDVAKLKLE LEKAHAHTKL LEVRATDAEK ALVEFQDSSR KESLQREQEI MSLMEQMKKD    780
SSERNQAASG AFNVELQSIR DAIEAAKETV RSKDDAYLRR CEALQRSLKA SEATTKMWRQ    840
RAEIAESLLL KERQPADQEE DSIYVVNGGR IDLLTNDDSQ KWKLLSDGPR REIPQWMARR    900
ICTIRTNFPP RKIDVAEALS SEFRSLNLPK PEEVWSIALE KPKEGDTLVE HVFEKEILEK    960
KRKALERALQ RKSTQWQRTE EQTKLEPGTG TGREIVFQGF NWESWRRQWY LDLAPKAADL    1020
SKIGVTSVWF PPPTESVAPQ GYMPSDLYNL NSAYGTEEEL KYCIAEMHAH DLLALGDVVL    1080
NHRCAHKQSP NGVWNIFGGK LAWGPEAIVC DDPNFEGRGN PSSGDIFHAA PNIDHSKDFV    1140
RNDIKEWLNW LRSDIGFDGW RLDFVRGFSG SYVKEYIEAS TPAFAIGEYW DSLAYENGNL    1200
CYNQDAHRQR IVNWINATGG SSSAFDVTTK GILHSALHNQ YWRLIDPQGK PTGVMGWWPS    1260
RAVTFLENHD TGSTQGHWPF PREKLTQGYA YILTHPGTPT IFYDHLYDFG LHEILTELIE    1320
ARRRAGIHCR SAVKIYHANN EGYVAQVGDS LVMKLGHFDW NPSKENHLEG SWQKFVDQGA    1380
 DYTVWLRQ*                                                           1440
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00200WD409.0e-49108410308+
PLN00196PLN001964.0e-1409941385406+
cd11314AmyAc_arch_bac_plant_AmyA1.0e-1629951333343+
PLN02361PLN023618.0e-1739921385399+
PLN02784PLN0278409821385408+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004556alpha-amylase activity
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3bsg_A099313561377A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
PDB2qps_A099313561377A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarb
PDB1rpk_A099313561377A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarb
PDB1p6w_A099313561377A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarb
PDB1ht6_A099313561377A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- Amylase Isozyme 1
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00499.1.534.822Aquca_002_00499.2.534.792Aquca_043_00069.1Aquca_015_00065.1Aquca_015_00064.1
Aquca_015_00064.2
Arabidopsis lyrata339218.513.801316534492338
Arabidopsis thalianaAT1G69830.1.517.806AT1G76130.1AT4G25000.1
Brachypodium distachyonBradi2g48150.1.502.788Bradi5g08800.3Bradi5g08800.1Bradi1g35050.1Bradi5g08800.2
Bradi4g32140.1Bradi3g58010.1
Brassica rapaBra016262.525.815Bra015784Bra036881
Carica papayaevm.model.supercontig_5.271.357.671evm.model.supercontig_26.242evm.model.supercontig_14.168evm.model.supercontig_49.22evm.model.supercontig_49.17
Capsella rubellaCarubv10019759m.532.819Carubv10020375mCarubv10004897m
Chlamydomonas reinhardtiiCre08.g362450.t1.2Cre08.g385500.t2.1Cre08.g385500.t1.2Cre08.g384750.t1.1
Citrus clementinaCiclev10018086mCiclev10030780m.385.674Ciclev10030661m.533.822Ciclev10001348mCiclev10001266m
Citrus sinensisorange1.1g045962morange1.1g006158m.291.578orange1.1g003698m.435.722orange1.1g003004m.533.820orange1.1g002611m.533.820
orange1.1g002585m.533.820orange1.1g003613m.533.791orange1.1g015125morange1.1g014892morange1.1g004353m.533.733
orange1.1g014447morange1.1g018278morange1.1g021281morange1.1g018833m
Cucumis sativusCucsa.285330.2.390.679Cucsa.285330.1.530.819Cucsa.271900.2Cucsa.271900.1
Eucalyptus grandisEucgr.G02543.2.545.839Eucgr.G02543.1.545.840Eucgr.F03529.1Eucgr.F02347.2Eucgr.F02347.1
Eucgr.F02347.4Eucgr.F02347.3Eucgr.F02349.1
Fragaria vescamrna08602.1-v1.0-hybridmrna28570.1-v1.0-hybridmrna28571.1-v1.0-hybrid
Glycine maxGlyma08g26861.3Glyma08g26861.2Glyma08g26861.1Glyma08g26861.4Glyma02g02450.1.530.816
Glyma08g40810.1.553.842Glyma14g39930.1Glyma17g36090.1
Gossypium raimondiiGorai.007G082900.3Gorai.007G082900.2Gorai.007G082900.1Gorai.007G082900.4Gorai.008G182600.3.522.810
Gorai.008G182600.1.524.812Gorai.005G139200.3Gorai.005G139200.2Gorai.005G139200.1Gorai.008G182600.6.524.783
Gorai.007G082900.5Gorai.010G001000.2Gorai.010G001000.1Gorai.009G268400.1Gorai.008G182600.4.524.727
Gorai.008G182600.5.524.726Gorai.008G182600.2.524.726Gorai.009G211600.1Gorai.009G211600.2Gorai.002G132300.1
Gorai.009G268400.2
Linum usitatissimumLus10036717.524.811Lus10013270.535.823Lus10030793.532.820Lus10037211.523.823Lus10021836
Lus10042655Lus10021728
Malus domesticaMDP0000210170MDP0000261503MDP0000162817.633.919MDP0000167257MDP0000298815.275.582
MDP0000298815.275.582MDP0000298815.637.941MDP0000298815.637.941MDP0000417791MDP0000135529
Manihot esculentacassava4.1_028069mcassava4.1_001555m.526.816cassava4.1_001362m.526.816cassava4.1_025145mcassava4.1_008802m
cassava4.1_008754mcassava4.1_008351mcassava4.1_008126mcassava4.1_023754m
Medicago truncatulaMedtr1g019440.1Medtr7g013300.1Medtr1g026170.1Medtr1g019480.1
Mimulus guttatusmgv1a001047mmgv1a001104m.518.806mgv1a001785mmgv1a007250mmgv1a006910m
Oryza sativaLOC_Os01g51754.2LOC_Os01g51754.1LOC_Os04g33040.1LOC_Os06g49970.2LOC_Os08g36900.1
LOC_Os08g36910.2LOC_Os08g36910.1LOC_Os09g28420.1LOC_Os08g36900.2LOC_Os09g28400.1
LOC_Os02g52700.1LOC_Os08g36910.3LOC_Os02g52710.1
Panicum virgatumPavirv00030888m.502.788Pavirv00061832m.515.801Pavirv00065049mPavirv00023068mPavirv00055456m
Pavirv00012930mPavirv00053436mPavirv00035106mPavirv00011095mPavirv00029041m
Pavirv00048051mPavirv00009684mPavirv00049157mPavirv00043521mPavirv00039683m
Pavirv00050888mPavirv00007311mPavirv00048050mPavirv00022620mPavirv00060260m
Pavirv00027292m
Physcomitrella patensPp1s342_20V6.1Pp1s100_191V6.1Pp1s223_59V6.2Pp1s223_59V6.1Pp1s13_335V6.1
Pp1s526_11V6.2Pp1s526_11V6.1Pp1s7_147V6.3Pp1s7_147V6.2Pp1s7_147V6.1
Pp1s148_45V6.1
Phaseolus vulgarisPhvul.008G033800.1Phvul.002G065700.1.549.837Phvul.003G069200.1.555.843Phvul.001G001900.1Phvul.010G017600.1
Picea abiesMA_30833g0020MA_17799g0010MA_400732g0010MA_336273g0010
Populus trichocarpaPotri.002G126300.1Potri.017G093200.1Potri.010G092900.7Potri.010G092900.5.536.826Potri.010G092900.4.532.822
Potri.010G092900.3.547.837Potri.010G092900.2.543.833Potri.010G092900.1.547.837Potri.010G092900.6.547.806Potri.002G014300.6
Potri.002G014300.5Potri.002G014300.4Potri.002G014300.3Potri.002G014300.2Potri.002G014300.1
Potri.014G029400.1Potri.002G126300.2
Prunus persicappa000951mppa001575m.432.720ppa006402mppa006152mppa006160m
Ricinus communis29630.m00083329736.m002033.533.82130170.m01430930170.m01387730170.m013878
32625.m000028
Setaria italicaSi000308m.516.802Si000258m.516.802Si010227mSi010224mSi006474m
Si013788mSi013755mSi022119mSi013704mSi029876m
Si029874mSi029873mSi013789mSi022334mSi008671m
Si006461mSi017283mSi032583mSi027629m
Selaginella moellendorffii127605976253394079072404058
Sorghum bicolorSb04g034150.1Sb03g032830.1.455.740Sb06g015110.1Sb02g026620.1Sb02g026610.1
Sb07g023020.2Sb07g023020.1Sb07g023010.1Sb02g023790.1Sb04g034140.1
Sb02g023250.1
Thellungiella halophilaThhalv10018099m.531.819Thhalv10018632mThhalv10018631mThhalv10025232m
Vitis viniferaGSVIVT01031746001GSVIVT01032922001GSVIVT01020069001.513.804GSVIVT01008714001GSVIVT01031740001
Volvox carteriVocar20003157mVocar20004587m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)