y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04322.1-v1.0-hybrid
FamilyGT35
Protein PropertiesLength: 1015 Molecular Weight: 115329 Isoelectric Point: 5.6067
ChromosomeChromosome/Scaffold: 6 Start: 33169474 End: 33176069
DescriptionGlycosyl transferase, family 35
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3560510080
  KASPKPPKLVRMANLCVVGGHAVNGVAEIHSEIVKDEVFNSFYKLWPKKFQNKTNGVTPRRWIRFCNPDLSSILTKWIGTEDWVLNTEKLAELRQYADDG
  DLQTQWRQAKRSNKLRVVSFIKERTGYSVSPDAMFDIQVKRIHEYKRQLMNILGIVYRYKKMKEMSASKRKAEFVPRVCMFGGKAFATYVQAKRIVKFIT
  DVGETVNHDPSIGDLLKVIFVPDYNVSVAELLIPASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGADNFFLFGAEAHEIAGLRKE
  RAEGKFVPDPRFEEVKEFIRSGVFGSYNYDDLIGSLEGNEGFGRADYFLVGKDFPSYIECQEKVDEAYRDQKKWTKMSILNTAGSSKFSSDRTIHEYAKD
  IWNI
GT351574810
  ALSKLGHKLETVAHQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQRITKEGQEEAAEDWLEMGNPWEILRNDVSYHVKFYGNVATGS
  DGKRHWIGGEDVVAVAYDVPIPGYKTKTTINLRLWSTKALSQDFDLYSFNSGEHTKAFEALANAEKICYVLYPGDDSLEGKTLRLKQQYTLCSASLQDIV
  ARFERRSGANVNWEEFPKKVAVQMNDTHPTLCIPELIRILMDLKGLTWKEAWSITQRTVAYTNHTVLPEALEKWSLELMQKLLPRHVEIIELIDEELINT
  IVSEYGTSDCDLLEKKLKEMRILEN
Full Sequence
Protein Sequence     Length: 1015     Download
MESLHYKSQS ELIGFGSRRS FSSRLLLART LSLNPRTHRS RCRRSVLVTN VIKDPTVEQE    60
TTLSSCTPDA VSIASSIKYH AEFTPSFSPE HFELPKAYFA TAQSVRDALI VNWNATNDYY    120
EKLNVKQAYY LSMEFLQGRA LLNAVGNLEL AGAYAEALSK LGHKLETVAH QEPDAALGNG    180
GLGRLASCFL DSLATLNYPA WGYGLRYKYG LFKQRITKEG QEEAAEDWLE MGNPWEILRN    240
DVSYHVKFYG NVATGSDGKR HWIGGEDVVA VAYDVPIPGY KTKTTINLRL WSTKALSQDF    300
DLYSFNSGEH TKAFEALANA EKICYVLYPG DDSLEGKTLR LKQQYTLCSA SLQDIVARFE    360
RRSGANVNWE EFPKKVAVQM NDTHPTLCIP ELIRILMDLK GLTWKEAWSI TQRTVAYTNH    420
TVLPEALEKW SLELMQKLLP RHVEIIELID EELINTIVSE YGTSDCDLLE KKLKEMRILE    480
NVDLPPTYAK LLFQPKKGSS VLPTEKLEDS NKDEKLEDSN KDEKLEDSEK DEKLEDSNKD    540
EKLEDSEKDE KLEDSNKDEK LEDSNKDEKL EDSEKDEKLE DSKKDVKALD EEIEPKKKPL    600
EEKKKASPKP PKLVRMANLC VVGGHAVNGV AEIHSEIVKD EVFNSFYKLW PKKFQNKTNG    660
VTPRRWIRFC NPDLSSILTK WIGTEDWVLN TEKLAELRQY ADDGDLQTQW RQAKRSNKLR    720
VVSFIKERTG YSVSPDAMFD IQVKRIHEYK RQLMNILGIV YRYKKMKEMS ASKRKAEFVP    780
RVCMFGGKAF ATYVQAKRIV KFITDVGETV NHDPSIGDLL KVIFVPDYNV SVAELLIPAS    840
ELSQHISTAG MEASGTSNMK FAMNGCILIG TLDGANVEIR EEVGADNFFL FGAEAHEIAG    900
LRKERAEGKF VPDPRFEEVK EFIRSGVFGS YNYDDLIGSL EGNEGFGRAD YFLVGKDFPS    960
YIECQEKVDE AYRDQKKWTK MSILNTAGSS KFSSDRTIHE YAKDIWNINP VELQ*         1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase4.0e-129157480324+
cd04300GT1_Glycogen_Phosphorylase9.0e-17874442372+
cd04300GT1_Glycogen_Phosphorylase06141008400+
pfam00343Phosphorylase06141010402+
TIGR02093P_ylase06141008400+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2azd_B06121006402792A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2azd_B012445057375A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2azd_A06121006402792A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2azd_A012445057375A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2aw3_B06121006402792A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)