y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04355.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 329 Molecular Weight: 36280.6 Isoelectric Point: 6.8875
ChromosomeChromosome/Scaffold: 6 Start: 33303576 End: 33304701
DescriptionUDP-glucosyl transferase 72B3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11473085.8e-32
  PLHIRELSKGLETSGYRFLWVLKTSKVDKDDIQEVSDMVGESFMERTKNKGIVLKAWVSQQDILEHPAIGGFVNHCGWNSVMEAAREGIPVLAWPQHGDQ
  SVNAEIVEKAGLGIWERKWGWGLEGLVSAEEIRNKIVELMEHEKVRSCSKKVGEEARKASGI
Full Sequence
Protein Sequence     Length: 329     Download
MSNSRDSHAQ PLLPHIALFP CAGMGHLTPF LRLASTLSSS QNCLVTLITA SPAVSAAEST    60
HISLFLSQHP KVNHLEFHLI PSDPTTTTIP DPFFLQWQST NHSLHLLYPS LASASPPLSA    120
IFSDFVVAPS MGTMAAQLNI PNYIFSPLHI RELSKGLETS GYRFLWVLKT SKVDKDDIQE    180
VSDMVGESFM ERTKNKGIVL KAWVSQQDIL EHPAIGGFVN HCGWNSVMEA AREGIPVLAW    240
PQHGDQSVNA EIVEKAGLGI WERKWGWGLE GLVSAEEIRN KIVELMEHEK VRSCSKKVGE    300
EARKASGIDG RSEKVVKEIM QSLMQKRN*                                      360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02534PLN025342.0e-29147328196+
PLN03004PLN030049.0e-30144292150+
PLN00164PLN001642.0e-33145328198+
PLN02554PLN025549.0e-34145321189+
PLN02167PLN021673.0e-35144324184+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A3e-26149316285460A Chain A, Cholesterol Oxidase From Streptomyces Glu361gln Mutant
PDB2vg8_A0.003141547146A Chain A, Cholesterol Oxidase From Streptomyces Glu361gln Mutant
PDB2vch_A3e-26149316285460A Chain A, Cholesterol Oxidase From Streptomyces Glu361gln Mutant
PDB2vch_A0.003141547146A Chain A, Cholesterol Oxidase From Streptomyces Glu361gln Mutant
PDB2vce_A3e-26149316285460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00760.1Aquca_002_00759.1
Brachypodium distachyonBradi1g44630.1Bradi1g43410.1
Citrus clementinaCiclev10013670mCiclev10031419m
Citrus sinensisorange1.1g043530morange1.1g012061m
Cucumis sativusCucsa.284670.1
Eucalyptus grandisEucgr.E03235.1Eucgr.E03236.1Eucgr.D01288.1Eucgr.E03234.1Eucgr.E03232.1
Eucgr.E03231.1Eucgr.J01468.1Eucgr.E03233.1
Fragaria vescamrna04357.1-v1.0-hybridmrna04359.1-v1.0-hybrid
Glycine maxGlyma09g29160.1Glyma16g33750.1
Gossypium raimondiiGorai.012G050700.1Gorai.013G091400.3Gorai.013G091400.2Gorai.013G091400.4
Linum usitatissimumLus10036967Lus10036969Lus10037114
Malus domesticaMDP0000286574MDP0000120215MDP0000253523MDP0000544455MDP0000548511
Manihot esculentacassava4.1_007235mcassava4.1_007252mcassava4.1_022558m
Medicago truncatulaMedtr4g082810.1Medtr6g078320.1Medtr4g082820.1
Mimulus guttatusmgv1a022922mmgv1a006046mmgv1a020049m
Oryza sativaLOC_Os06g18670.1LOC_Os06g18010.1LOC_Os06g18140.1LOC_Os06g18790.1
Panicum virgatumPavirv00001007mPavirv00009357mPavirv00054865m
Phaseolus vulgarisPhvul.004G138400.1Phvul.004G138200.1Phvul.004G137900.1Phvul.004G137900.2
Populus trichocarpaPotri.017G089000.1Potri.004G126000.1
Prunus persicappa005427mppa027121mppa015845mppa023609m
Ricinus communis28124.m000238
Setaria italicaSi007944mSi006299mSi006342m
Sorghum bicolorSb10g001230.1Sb07g002370.1Sb10g010640.1Sb10g010590.1Sb10g010610.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny