y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04398.1-v1.0-hybrid
FamilyGH81
Protein PropertiesLength: 689 Molecular Weight: 75833.6 Isoelectric Point: 5.5687
ChromosomeChromosome/Scaffold: 6 Start: 33475757 End: 33477823
Descriptionglycosyl hydrolase family 81 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81446830
  TVLPDPSPFFASNLLQAPLPTNSFFQNFVLNNGDAAEYFHPYSFRFSNSSLTLSYPTPIPSNASILQNFTADLTISTTQTQHQHQVVSSFSDLGVTLDIP
  SSNLRFFLVKGSPYLTCNVSVPTALSISTTHAITSLSPNTKQNKYTINLNNNQTWILYSSSKIGLTKTNPSLIKSDSFFGVIRVALSPGSDAEKVLDQFS
  SSYPVSGEALFTEAFGLEYNWEKQGNGDLLMLAHPLHLQLLSVEDRNVTVLDHFRYRSIDGDLVGVVGDSWVLKTQPIPITWHSINGIKDNASIPEITAA
  LLTDVEAVTSEPISSITASYFYGKMIAKAARLALIAEEVGCDNVIPNITTFLKNAIEPWLSGTFGGNGFLYEAKWSGLVTKNGAVDKGADFGFGIYNDHH
  YHIGYFVYAIAVVAKLDQAWGLKFKTQACSLAEDFMNLNRQPSSNYPRLRNFDLYNLHSWAGGLTEFGDGRNQESSSEAVNAYYSAALMGLAYGDTNLTA
  TGSLLAALEIQATQKWWHVHQGDNIYEDVFTSANKITGIVWSDKRDTGLWFAPQTSLEIRVGIQVLPISPITEVLFSNVSYVKELVEWTAPALTKEGVTD
  AWRGFDYSLEGIYNKQDALQKIKNLGGFDDGNSLTNLLWW
Full Sequence
Protein Sequence     Length: 689     Download
MLSSKMTFYI FILVLGFSFL QTQARALPSK PAPAAVLFPQ VQSTVLPDPS PFFASNLLQA    60
PLPTNSFFQN FVLNNGDAAE YFHPYSFRFS NSSLTLSYPT PIPSNASILQ NFTADLTIST    120
TQTQHQHQVV SSFSDLGVTL DIPSSNLRFF LVKGSPYLTC NVSVPTALSI STTHAITSLS    180
PNTKQNKYTI NLNNNQTWIL YSSSKIGLTK TNPSLIKSDS FFGVIRVALS PGSDAEKVLD    240
QFSSSYPVSG EALFTEAFGL EYNWEKQGNG DLLMLAHPLH LQLLSVEDRN VTVLDHFRYR    300
SIDGDLVGVV GDSWVLKTQP IPITWHSING IKDNASIPEI TAALLTDVEA VTSEPISSIT    360
ASYFYGKMIA KAARLALIAE EVGCDNVIPN ITTFLKNAIE PWLSGTFGGN GFLYEAKWSG    420
LVTKNGAVDK GADFGFGIYN DHHYHIGYFV YAIAVVAKLD QAWGLKFKTQ ACSLAEDFMN    480
LNRQPSSNYP RLRNFDLYNL HSWAGGLTEF GDGRNQESSS EAVNAYYSAA LMGLAYGDTN    540
LTATGSLLAA LEIQATQKWW HVHQGDNIYE DVFTSANKIT GIVWSDKRDT GLWFAPQTSL    600
EIRVGIQVLP ISPITEVLFS NVSYVKELVE WTAPALTKEG VTDAWRGFDY SLEGIYNKQD    660
ALQKIKNLGG FDDGNSLTNL LWWIHSRG*                                      720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF22.0e-6338686708+
pfam03639Glyco_hydro_81038687701+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Transmembrane Domains
StartEnd
724
Signal Peptide
Cleavage Site
26
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)