y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04399.1-v1.0-hybrid
FamilyGH81
Protein PropertiesLength: 694 Molecular Weight: 76033.8 Isoelectric Point: 5.0277
ChromosomeChromosome/Scaffold: 6 Start: 33479539 End: 33481620
Descriptionglycosyl hydrolase family 81 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81496880
  LPDPSPFFAPNLLQTPLPTNSFFQNFVLNNGDDPEYFHPYHFRSSNSSLSLSYPSRLATPSFISQNFTAQLSISATQNNHERHVVSSFSDLSVTLDFPSS
  NLTFFLVKGSPYLTCNVSKPTALSISTALSVTSLSSNAERTKFTLKLDNSQIFLVYSSSPIGLTISNPSLITSEAFTGVIRVAMLPPSGSQDLEAILDQF
  SSSYPISGEAVLTGPTTLEYRWVKEGNGDLLMLAHPLHQQLLSVQDSHAAVLDYFKYTSIDGDLIGVVGNSWVLKAQPIPISWHSITGVKDLVQALPEIN
  AALSSDVQLLISTPLSITGSYEYGKLLAKAARLALIAEEVGSNDIAVITKFLKDGIEPWLSGTFSGNGFLYEGKWGGLVTKNGAADKGADYGFGVYNDHY
  YHIGYFLYAISVAAKFDVDWGMKFKAQAYALAGDFMNLNRQADSSYTRLRNFDLYNLHSWAGGVTEFADGRNQESSSESVNAYYSAALMGLAYRDTNLTD
  AASLLAALEIQAIQKWWHVHQGDNIYEDVFASENKITGIVWSNKRDSSLWFASAESKEIGVGIQVMPISPITEVLFSNASYVKELVEWTAPALSKEGVTD
  AWRGFTYALEGIYNKAEALQKIKNLGGFDDGNSLTNLLWW
Full Sequence
Protein Sequence     Length: 694     Download
MASPLTFFLI ISLSFFITLP QTQARVLLSQ PQPTPATSFI FPKAESTFLP DPSPFFAPNL    60
LQTPLPTNSF FQNFVLNNGD DPEYFHPYHF RSSNSSLSLS YPSRLATPSF ISQNFTAQLS    120
ISATQNNHER HVVSSFSDLS VTLDFPSSNL TFFLVKGSPY LTCNVSKPTA LSISTALSVT    180
SLSSNAERTK FTLKLDNSQI FLVYSSSPIG LTISNPSLIT SEAFTGVIRV AMLPPSGSQD    240
LEAILDQFSS SYPISGEAVL TGPTTLEYRW VKEGNGDLLM LAHPLHQQLL SVQDSHAAVL    300
DYFKYTSIDG DLIGVVGNSW VLKAQPIPIS WHSITGVKDL VQALPEINAA LSSDVQLLIS    360
TPLSITGSYE YGKLLAKAAR LALIAEEVGS NDIAVITKFL KDGIEPWLSG TFSGNGFLYE    420
GKWGGLVTKN GAADKGADYG FGVYNDHYYH IGYFLYAISV AAKFDVDWGM KFKAQAYALA    480
GDFMNLNRQA DSSYTRLRNF DLYNLHSWAG GVTEFADGRN QESSSESVNA YYSAALMGLA    540
YRDTNLTDAA SLLAALEIQA IQKWWHVHQG DNIYEDVFAS ENKITGIVWS NKRDSSLWFA    600
SAESKEIGVG IQVMPISPIT EVLFSNASYV KELVEWTAPA LSKEGVTDAW RGFTYALEGI    660
YNKAEALQKI KNLGGFDDGN SLTNLLWWIH SRG*                                720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF29.0e-5564691690+
pfam03639Glyco_hydro_817.0e-16545692698+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Signal Peptide
Cleavage Site
24
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)