y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04524.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 473 Molecular Weight: 51125.4 Isoelectric Point: 6.3235
ChromosomeChromosome/Scaffold: 4 Start: 26240883 End: 26242301
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12724481.9e-31
  MAWLDGCPDGSVLYVGFGSQKLLDSKQMEALASGLELSGVRFVWTVKTGSAQETKDGYGIVPEGFEERVAGRGRMVKGWSPQVLILGHRAVGGFVSHCGW
  NSVLEAIAGGVLILGWPMEADQYVNAKLLVEDLGVAIQVCEGASGVPDPAQLGKVIAESLSGDSAEKVRAKELRDKA
Full Sequence
Protein Sequence     Length: 473     Download
MSTSGDQNHR HPHILVYPYP AQGHMLPLLD LTNQLALRHL TITLIITPKN LPTLTPLLSS    60
HPSIQTLVLP FPSHPKIPPG VENVKDLGTH GNLSVINALA NLHDPIIQWF NSHPNPPVAL    120
ISDFFLGYTL RLADHLKIPR ITFFSSGAYL ASIHEYCWRN LDLVQSSSNV IDFPYVPRKP    180
SLKKEHVPSI VLAHKGADPE SELLRVSMLA NTDSWGCVFN SFQDLEGEYL DHLKRRMGHN    240
RVYGVGPLSL IDAGDGGLDR GNLNTGSGGD VMAWLDGCPD GSVLYVGFGS QKLLDSKQME    300
ALASGLELSG VRFVWTVKTG SAQETKDGYG IVPEGFEERV AGRGRMVKGW SPQVLILGHR    360
AVGGFVSHCG WNSVLEAIAG GVLILGWPME ADQYVNAKLL VEDLGVAIQV CEGASGVPDP    420
AQLGKVIAES LSGDSAEKVR AKELRDKAFS AVSDGGSSVR DLDELVKELS LL*           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03004PLN030044.0e-5314458465+
PLN02167PLN021675.0e-56118466373+
PLN02534PLN025341.0e-6912469490+
PLN03007PLN030072.0e-758471489+
PLN02863PLN02863013472464+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A074622460A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB2vch_A074622460A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB2vce_A074622460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A1.4013e-4554712479A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B2.8026e-4594707462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)