y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna04987.1-v1.0-hybrid
FamilyGT22
Protein PropertiesLength: 583 Molecular Weight: 65852.9 Isoelectric Point: 9.3336
ChromosomeChromosome/Scaffold: Start: 10162197 End: 10166563
DescriptionAlg9-like mannosyltransferase family
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT221074880
  FLTYFNPDEHWQALEVAHRITFGFGHLTWEWKQGIRSYLHPLLFAFLYKVLALLGLDTPLFMIKSPRLFQSLFSAFGDLYLYKLSVVLFGDQVAKWALFV
  LQGELNSVSAFFPIDKLVYVFLPQSPSSSKLPLGSRKWGLIFAALACAIRPTSAIIWLYVGILELLVSCDKPRFIFLEVAPIGVLVLGLTFLVDRLMYGS
  WILVPLNFLRFNFLSSGGDYYGTHKWHWYFTQGFTVMVFTYLPFSIAGIMQSKQWKLSGLIAWVLGLYSVLGHKEFRFVLPVLPIALIFSGYALAELKSS
  ISGCGQRKESADYHNKCPAKMHLAIFFLLATNIPMALYMSLVHQRGTEDVTYYLSKEVVEGKVTDILFLMPCHATPYYSTVH
Full Sequence
Protein Sequence     Length: 583     Download
MKVESRRGRR RLIDDGCSAC SSFKKKIGCS KGSEKVRWPG TSPCTTRPGP NKSKTNKDPL    60
KSPARPSAVR SGPLFLPPRV FGPAHYYTHS PLLALRFYGS TSINDEFLTY FNPDEHWQAL    120
EVAHRITFGF GHLTWEWKQG IRSYLHPLLF AFLYKVLALL GLDTPLFMIK SPRLFQSLFS    180
AFGDLYLYKL SVVLFGDQVA KWALFVLQGE LNSVSAFFPI DKLVYVFLPQ SPSSSKLPLG    240
SRKWGLIFAA LACAIRPTSA IIWLYVGILE LLVSCDKPRF IFLEVAPIGV LVLGLTFLVD    300
RLMYGSWILV PLNFLRFNFL SSGGDYYGTH KWHWYFTQGF TVMVFTYLPF SIAGIMQSKQ    360
WKLSGLIAWV LGLYSVLGHK EFRFVLPVLP IALIFSGYAL AELKSSISGC GQRKESADYH    420
NKCPAKMHLA IFFLLATNIP MALYMSLVHQ RGTEDVTYYL SKEVVEGKVT DILFLMPCHA    480
TPYYSTVHRN LPMRFLDCTP SEEKGTPDES DRFMMDPVGF ASEFAKNWSL PSHIVIFDSE    540
EKKLRDFLVS HSFKEAHDYC LCTDKSAMKS FASVVVQLAE SP*                      600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_226.0e-9592488426+
PLN02816PLN028160109576485+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Transmembrane Domains
StartEnd
147169
245267
280299
334356
384401
429448
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4
Gorai.010G092100.3Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny