y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna05024.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 647 Molecular Weight: 73300.8 Isoelectric Point: 6.6817
ChromosomeChromosome/Scaffold: 4 Start: 21902560 End: 21906682
DescriptionGlycosyl hydrolase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11475420
  VEGDTGEEDEEKPAPTEECHHKVAAWHNVEHPEERIKFWSDPDTELKLAKDTGVSVFRMGIDWSRVMPKEPLNGLAETVNYAALERYKWIISRVRSYGMK
  VMLTLFHHSLPPWAGEYGGWKSEKTVGYFLDFTRLVVDSVSDMIDYWIPFNEPHVFCMLTYCAGAWPGGHPDMLEAATSALPTGVFMQAMHWMAIAHLKA
  YDYIHEKSTSSKPLVGVAHHVSFMRPYGLFDVPSVLLANSMTIFPYVDSISDKLDFIGINYYGQEVVCGAGLKLVETDEYSESGRGIYPDGLYRMLLQFN
  DRYKHLNVPFIITENGVSDKTDIIRRPYLLEHLLAVHAAKIMGVRVLGYMFWTISDNWEWADGYGPKFGLVAVDRSKDLARIPRPSYHLFTKVVTT
Full Sequence
Protein Sequence     Length: 647     Download
MAVVALFVTA TKLAGLLATV TVAANVFSFS RYRKQNLRPF RSPINESDDT LADFNLNEGE    60
DGFFFGLATA PAHVEDKLDD AWLQFAQENP CDKVESEGDR QPADAMMGSA TADGGSQAAP    120
PSGKPKKKKK PLKIAMEAMI RGYAKYVEGD TGEEDEEKPA PTEECHHKVA AWHNVEHPEE    180
RIKFWSDPDT ELKLAKDTGV SVFRMGIDWS RVMPKEPLNG LAETVNYAAL ERYKWIISRV    240
RSYGMKVMLT LFHHSLPPWA GEYGGWKSEK TVGYFLDFTR LVVDSVSDMI DYWIPFNEPH    300
VFCMLTYCAG AWPGGHPDML EAATSALPTG VFMQAMHWMA IAHLKAYDYI HEKSTSSKPL    360
VGVAHHVSFM RPYGLFDVPS VLLANSMTIF PYVDSISDKL DFIGINYYGQ EVVCGAGLKL    420
VETDEYSESG RGIYPDGLYR MLLQFNDRYK HLNVPFIITE NGVSDKTDII RRPYLLEHLL    480
AVHAAKIMGV RVLGYMFWTI SDNWEWADGY GPKFGLVAVD RSKDLARIPR PSYHLFTKVV    540
TTGKITRYDR ARAWHQLQIA ARAKETRSFY RAVNKNGLMY AGGLDEPIQR PYVERDWRFG    600
HYEMEGLQDP LCRLWRFMTR PATATLNFRK RKPQMNEEDE ALLAIQ*                  660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG6.0e-22178520416+
PRK13511PRK135117.0e-30191545432+
TIGR03356BGL3.0e-52192536389+
pfam00232Glyco_hydro_11.0e-55189542410+
COG2723BglB1.0e-65178546425+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ha4_A9.99995e-4117654651469A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB4ha3_A9.99995e-4117654651469A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris
PDB3apg_D3e-3817854552457A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C3e-3817854552457A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_B3e-3817854552457A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Transmembrane Domains
StartEnd
224
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10043048Lus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny