y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna05309.1-v1.0-hybrid
FamilyGT22
Protein PropertiesLength: 356 Molecular Weight: 40140.6 Isoelectric Point: 8.315
ChromosomeChromosome/Scaffold: 3 Start: 9827627 End: 9835377
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22171702.6e-33
  LLGSVAAFYVFMAPYTKVEESFNVQAMHDILYHRQNLDNYDHLEFPGVVPRTFLGAFLVSSLASPAILAMNLLHMPKIYGLFTVRLTVGCIILSTLRFFR
  LQVREKFGRQVEAYFVMLTAAQFHLLFYCTRPLPNILALGAVNLAYGYWLKEKS
Full Sequence
Protein Sequence     Length: 356     Download
MASKSSKFLE RFGYDVLLGS VAAFYVFMAP YTKVEESFNV QAMHDILYHR QNLDNYDHLE    60
FPGVVPRTFL GAFLVSSLAS PAILAMNLLH MPKIYGLFTV RLTVGCIILS TLRFFRLQVR    120
EKFGRQVEAY FVMLTAAQFH LLFYCTRPLP NILALGAVNL AYGYWLKEKS YAALNCLELR    180
FIIGSIPIFN LSAAVAAARM EQYSVTSSAD LMLCSLGCTA ITFMASNENY PSGHALQHLH    240
KIGHLGNRTN EILVHIDTYS AMNGISRFCE HDFPWRYSKE EGIPGEELCQ RNFNYLINEH    300
PAINGFKCLS AVNGFSRVRL QNGFPPILLV KEPKVYIHGN VRHSDILDRI WPGCS*        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_222.0e-726171148+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Transmembrane Domains
StartEnd
1229
6890
97115
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny