y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna05486.1-v1.0-hybrid
FamilyGT68
Protein PropertiesLength: 557 Molecular Weight: 63342.1 Isoelectric Point: 6.9704
ChromosomeChromosome/Scaffold: 6 Start: 27940101 End: 27942714
DescriptionO-fucosyltransferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682385310
  NRILVIPSSKVDYQYSTVLDIEHINKCIGRKVVVTFEELAEEKKNHIHIDRFICYFSKPTLCYVDDEHLKKLKALGISYKSREPAWGEDVKKPSKKTVQD
  VQSKFSSGDEVIAIGDVFFADAEQDWVMQPGGPLAHKCKTLIEPSRLILLTAQRFIQTFLGKNFVALHFRRHGFLKFCNNKQPSCFYPIPQAADCITRIA
  ERANAPVVYLSTDAAESETGLLQSLVVVNGKTVPLVKRPARNSAEKWDALLYRHGIEGDPQVEAMLDKTISAMSSVFIGASGSTFTEDILRLRK
Full Sequence
Protein Sequence     Length: 557     Download
MDRPDSLSSD DEVEDDRQNL IEQNDRKQLP SPRSATTFHI DDGDVDRHRH HREIRRRFAS    60
LNLRDLFNKR SFLVFFIFIP LFVLVLFFST DIKSLFFSHL SVSDSVSGKL RESELRALYL    120
LRQQQLGLFG LWNSTSNHSN PDLDDLKSSV LRQISLNKEI QQVLLSPHSS GNSSESEDFR    180
DPSLGDRCRV VDQRFSERRT IEWKPNSDKY LLAICVSGQM SNHLICLEKH MFFAALLNRI    240
LVIPSSKVDY QYSTVLDIEH INKCIGRKVV VTFEELAEEK KNHIHIDRFI CYFSKPTLCY    300
VDDEHLKKLK ALGISYKSRE PAWGEDVKKP SKKTVQDVQS KFSSGDEVIA IGDVFFADAE    360
QDWVMQPGGP LAHKCKTLIE PSRLILLTAQ RFIQTFLGKN FVALHFRRHG FLKFCNNKQP    420
SCFYPIPQAA DCITRIAERA NAPVVYLSTD AAESETGLLQ SLVVVNGKTV PLVKRPARNS    480
AEKWDALLYR HGIEGDPQVE AMLDKTISAM SSVFIGASGS TFTEDILRLR KGWGSASVCD    540
EYLCQGEEPN FIAENE*                                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like0.002376532163+
pfam10250O-FucT2.0e-5233523328+
cd11296O-FucT_like1.0e-521025142+
cd11298O-FucT-23.0e-6397523131+
cd11296O-FucT_like7.0e-17371530170+
Transmembrane Domains
StartEnd
7190
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny