y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna05979.1-v1.0-hybrid
FamilyGT4
Protein PropertiesLength: 721 Molecular Weight: 80447.5 Isoelectric Point: 10.4069
ChromosomeChromosome/Scaffold: 6 Start: 23920615 End: 23924868
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45636893.7e-25
  KFLIGSVGSKSNKVAYVKELLSYLSQHSNLSKSVLWTPSTTRVAALYSAADVYVMNSQGLGETFGRVTIEAMAFGLPVLGTDAGGTKEIVDHNVTGLLHP
  LGHPGTQVLAKNLRLLLKNPELRKQMG
Full Sequence
Protein Sequence     Length: 721     Download
MEEETKGDYK ASRGIGSFKS TLSGRSSPRS SPSFKRLHSS RTPRREARSS GGVQWFRSNR    60
LLFWLLLITL WAYLGFYFQS SWAHSNNKVN FLGVGNEASN DKSDAEQNQR RDLLDSPVKL    120
KNETGQNQPE AGKTIDVVLA KKDDGVASRR SLSSKKKSKK AARGKSHGKP KKTVAIEIHE    180
IEEQEPDIPK TNASYGMLVG PFGSTEDRIL EWNPKTRTGT CDRKGDFSRL VWSRRFLLIF    240
HELSMTGAPL SMMELATELL SCGATVSAIV LSKKGGLMPE LTRRRIKVLE DKADHSFKTA    300
MKQDLVIAGS AVCASWIDQY IDKFPAGASQ IAWWIMENRR EYFDRAKVVL DRVKMLAFLS    360
ESQSKQWLDW CEEEKIKLRS QPAIVPLSIN DELAFVAGIG CSLNTPSSSI EKMLEKMKLL    420
RDAVRKEMGL TDNDMLAISL SSINPGKGQL LVLNSARLVI EEEPQPDNSK IKNSVRKGRV    480
RSALARKHHI RALLQGSNDH SASLNGFPLS TESSVHFKED QKKHLHLHNR FASVDDTDAM    540
NFDVTYKRKV LADNGGTVKQ SAKFLIGSVG SKSNKVAYVK ELLSYLSQHS NLSKSVLWTP    600
STTRVAALYS AADVYVMNSQ GLGETFGRVT IEAMAFGLPV LGTDAGGTKE IVDHNVTGLL    660
HPLGHPGTQV LAKNLRLLLK NPELRKQMGV KGREKVERMY LKRHMYKKFV DVLLKCMRPK    720
*                                                                    780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03800GT1_Sucrose_synthase1.0e-2160470097+
COG0438RfaG2.0e-22562720161+
TIGR00072hydrog_prot5.0e-24580711133+
cd03808GT1_cap1E_like1.0e-25591711121+
cd03801GT1_YqgM_like5.0e-32562713154+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.0000000002586718259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.0000000002586718259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.0000000002586718259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.0000000002586718259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.0000000002586718259387A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
6183
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4
Glyma15g01640.3Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)