y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06055.1-v1.0-hybrid
FamilyGH35
Protein PropertiesLength: 1413 Molecular Weight: 158167 Isoelectric Point: 7.6681
ChromosomeChromosome/Scaffold: 4 Start: 16578952 End: 16587416
Descriptionglycosyl hydrolase family 35 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3512820
  MWPDLLRKAKHGGLNVIQTYVFWNVHEPVKGHYNFSGNYDLVRFIKLVQEHGMYVTIRVGPFIQAEWNHGGLPYWLREVPDLIFRTDNAPYKYYMKKYVT
  MIVNKLKEAKLFSPQGGPIILAQIENEYNHIQLAYEENGSNYVRWAAKMAVKQNVGVPWIMCKQTDAPDPAINTCNGRHCGDSFSGANKPYKPALWTENW
  TGQYRVFGDPASQRPAEDIAFSVARFFSKNGSLANYYMYHGGTNFGRTSAIFTTTRYYDEAPLDEYGLPRDPKWSHLKDLHK
Full Sequence
Protein Sequence     Length: 1413     Download
MWPDLLRKAK HGGLNVIQTY VFWNVHEPVK GHYNFSGNYD LVRFIKLVQE HGMYVTIRVG    60
PFIQAEWNHG GLPYWLREVP DLIFRTDNAP YKYYMKKYVT MIVNKLKEAK LFSPQGGPII    120
LAQIENEYNH IQLAYEENGS NYVRWAAKMA VKQNVGVPWI MCKQTDAPDP AINTCNGRHC    180
GDSFSGANKP YKPALWTENW TGQYRVFGDP ASQRPAEDIA FSVARFFSKN GSLANYYMYH    240
GGTNFGRTSA IFTTTRYYDE APLDEYGLPR DPKWSHLKDL HKALRLCRKP LLWGVPGVQN    300
LGKNIEARFY ELKGNSSICA AFLANNNSRS EAIVNWRGQD YYLPPHSISI LPDCKTVVYN    360
TQTIVSQHNA RSFVGSNLAN KMRWMESPEP IPSTKEIPIN NRTPLELYGL LKDNSDYAWY    420
TTSLELNSMD MSMKKSIQPV LRVGSLGHAM LVFVNGEYVG SGHGSHDEKS FVFEKVVSFK    480
AGVNQIALLA MTVGLPDSGA YMEHRYAGPK DIVVLGLNTG TLDLTQNGWG HQVGLNGEKL    540
RAFTKEGSKQ VQWGETNGPK KALTWYKTYF DAPEGNDPVA IRMTGMGKGM IWVNGESIGR    600
HWISFLSPLG QPTQSEYHIP RSFIKPRKNL LVVLEEELAK PSSIDIVTVN RDTICSFITE    660
YHPPNVKSWA RQNSVFRPVL DVVRTSAELK CPNYKKVVAV EFASFGDPTG SCGSYTLGKC    720
NSPVSKEVVE QHCLGNTSCV VPIDRNVYFK NNDECPDIKK TLAIQMEQRK WEDLDKDCLV    780
KVFEKVDMES LLLDIPFVCK SWHKETLNPS CWNSLIFPDF EPEFPYNERD YPIFDRFVSE    840
FGLDRDHFSV TAFIKFVVNR SQGNAVSLKL PGCSSLEAFE YVTDECPNIM FFGLPRCLLW    900
KDDIDLELMG KFKNLFMLAL GCSTYLDRVL AVVNKHCKLF SHLILSNAQI GKKEATAIVN    960
LIPDIKLLSL NDAQIDRDYL IILLKGCKEL VMLEAKDCIG FDEGDDEIAK MASHRLMQRQ    1020
RLMERVRVRV RERERLILKI GLNLDLALYN EQAGGDSYPF LGSLRGMESE GEAFGSRRQR    1080
ETGSLEEGRG LSFNGGMLIL AEYDGLSPME DVSLHYLEVW VSVTELRFAM RNNMVLSHAV    1140
NGLGVFVRAD LGPIQRKEKI QRVRVVLDVR NRIPAKRIFD YSPEVAVKLE FKVERAHGIC    1200
KDCGYFGHGG GTCDKGSICG LPMVNVVSVV DCEAELLASR SMDGLLKEPV LQVDEAAPTG    1260
LEVGMSGNEE AVALVVTPPT FSAGNPSFKL GLTNGIGLGG FRGPLRIGPG DSGFKRKFGF    1320
GSESDGFGLS GDGPAGTDLM LKKPKSSFSG ELVEVPVQFG RIPQKKSPKK RGRPRGSRNK    1380
KRTMNGDPEF SMAPSLEGAN VETGLESEAE EE*                                 1440
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_422.0e-72128141+
COG1874LacA4.0e-121128139+
pfam02140Gal_Lectin4.0e-1468976581+
pfam01301Glyco_hydro_354.0e-1311284298+
PLN03059PLN0305901765790+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A1e-34228039325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.004548645493580A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D2e-33226742318A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.002528663503630A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C2e-33226742318A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)