y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06375.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 278 Molecular Weight: 31043.8 Isoelectric Point: 6.2519
ChromosomeChromosome/Scaffold: 5 Start: 4972540 End: 4973996
Descriptionbeta glucosidase 17
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH122660
  GYDLGVAPPGRCSVRAPQNKIECKDGNSSTEPYIVTHNLILSHATVVELYRENFQSKQGGKIGWSLVGQYVEPYSDAAEDKAAAKSKLDVYGDYPKIMRD
  LVNERRTSFTEEEKNLIKGSFDFIGVNYYTTRYGKNAPASQAEPLSYHSDSLATSTETNANGVLIGPHVDGSFYIFSYPEGLQKLLEFMKQNYQSPTIYI
  TENGITEARNDTLALDAQLRDPHRIECILRLLYRIKMAMKNGVNVKGYFHWALFDNFEWAQGYTP
Full Sequence
Protein Sequence     Length: 278     Download
MGYDLGVAPP GRCSVRAPQN KIECKDGNSS TEPYIVTHNL ILSHATVVEL YRENFQSKQG    60
GKIGWSLVGQ YVEPYSDAAE DKAAAKSKLD VYGDYPKIMR DLVNERRTSF TEEEKNLIKG    120
SFDFIGVNYY TTRYGKNAPA SQAEPLSYHS DSLATSTETN ANGVLIGPHV DGSFYIFSYP    180
EGLQKLLEFM KQNYQSPTIY ITENGITEAR NDTLALDAQL RDPHRIECIL RLLYRIKMAM    240
KNGVNVKGYF HWALFDNFEW AQGYTPSGSS VAISNIS*                            300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL2.0e-331266279+
PLN02998PLN029981.0e-362267276+
PLN02849PLN028491.0e-452267279+
PLN02814PLN028141.0e-463267279+
pfam00232Glyco_hydro_15.0e-532265277+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B02265206474A Chain A, Crystal Structure Of Susd Superfamily Protein (bt_2365) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.49 A Resolution
PDB3ptq_A02265206474A Chain A, Crystal Structure Of Susd Superfamily Protein (bt_2365) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.49 A Resolution
PDB3ptm_B02265206474A Chain A, Crystal Structure Of Susd Superfamily Protein (bt_2365) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.49 A Resolution
PDB3ptm_A02265206474A Chain A, Crystal Structure Of Susd Superfamily Protein (bt_2365) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.49 A Resolution
PDB3ptk_B02265206474A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna09907.1-v1.0-hybrid
Malus domesticaMDP0000320822.209.384MDP0000320822.209.384
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny