y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06376.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 552 Molecular Weight: 62124 Isoelectric Point: 5.9331
ChromosomeChromosome/Scaffold: 5 Start: 4974383 End: 4977008
Descriptionbeta glucosidase 15
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1585440
  RSDFPADFTFGVATSAAQTEGSAREGGRGPSTWDHRVDILPDAIINSDKFSTAIDSYRRYKEDIKIIKDLGVNAYRFSISWSRILPKGSLSGGINQEGID
  HYNSFIDDLIRNGIEPFVTILHSDLPQALEDKYGGYLNHSFVNDFKDYSEICFKSFGDRVKNWFTINEPTVSAVYGYELGIAPPGKCSLKEGVCVFGTPD
  NCLVPAGPCNFGGDSSTEPYIVAHNQILGHATVAKLYKEKYKAQQKGEIGIVLASKYYVPFSNSPEDKVAAERLFDFNLGWFMEPFVYGDYPKSMRELVK
  ERLPSFSAQEQSLIKGCLDFVGINYYTSSYARHKTPPPLEQFRYSFDISAEETGMKDGDFLGMDHEGHWPEGLQKLMEYMMEKYQNPKIYISENGLYTTR
  NDELSLVDQLNDTNRISFLVRHLYRLNKAIKNGVNVKGYFYWSLFDDFEWGMGFLHRYGLYHIDFDHNNRRIPKQSADWFKAFLQSD
Full Sequence
Protein Sequence     Length: 552     Download
MASSTKFSGV VIVAVSAIMA SIAGCYARAT IPDFNGGVAG KLKLYSSSAF LDELDVSRSD    60
FPADFTFGVA TSAAQTEGSA REGGRGPSTW DHRVDILPDA IINSDKFSTA IDSYRRYKED    120
IKIIKDLGVN AYRFSISWSR ILPKGSLSGG INQEGIDHYN SFIDDLIRNG IEPFVTILHS    180
DLPQALEDKY GGYLNHSFVN DFKDYSEICF KSFGDRVKNW FTINEPTVSA VYGYELGIAP    240
PGKCSLKEGV CVFGTPDNCL VPAGPCNFGG DSSTEPYIVA HNQILGHATV AKLYKEKYKA    300
QQKGEIGIVL ASKYYVPFSN SPEDKVAAER LFDFNLGWFM EPFVYGDYPK SMRELVKERL    360
PSFSAQEQSL IKGCLDFVGI NYYTSSYARH KTPPPLEQFR YSFDISAEET GMKDGDFLGM    420
DHEGHWPEGL QKLMEYMMEK YQNPKIYISE NGLYTTRNDE LSLVDQLNDT NRISFLVRHL    480
YRLNKAIKNG VNVKGYFYWS LFDDFEWGMG FLHRYGLYHI DFDHNNRRIP KQSADWFKAF    540
LQSDQVTRAS S*                                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028145.0e-12757541489+
PLN02849PLN028492.0e-13055542491+
COG2723BglB7.0e-13861543490+
TIGR03356BGL3.0e-14862537479+
pfam00232Glyco_hydro_14.0e-17061540483+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B0195412503B Chain B, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat
PDB3ptq_A0195412503B Chain B, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat
PDB3ptm_B0195412503B Chain B, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat
PDB3ptm_A0195412503B Chain B, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat
PDB3ptk_B0195412503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Transmembrane Domains
StartEnd
729
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00603.1Aquca_011_00256.1Aquca_011_00258.1Aquca_011_00256.2Aquca_007_00604.1
Fragaria vescamrna06378.1-v1.0-hybrid
Malus domesticaMDP0000239732MDP0000143078MDP0000303677MDP0000235546
Manihot esculentacassava4.1_026312m
Picea abiesMA_70066g0010
Prunus persicappa027074m
Ricinus communis30147.m01453830147.m014539
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny